Gene [POPLAR] | FIBexDB

Potri.019G102800 [POPLAR]

External link

JGI Phytozome v13

[genome browser]

Popgenie

AspWood

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	Alias	TAIR10 short description
AT2G20875	118 / 9e-36	EPF1	epidermal patterning factor 1 (.1)
AT1G34245	66 / 4e-15	EPF2	EPIDERMAL PATTERNING FACTOR 2, Putative membrane lipoprotein (.1)
AT1G71866	64 / 1e-13		unknown protein
AT2G30370	42 / 9e-06	EPFL6, CHAL	EPF1-like 6, CHALLAH, allergen-related (.1.2)
AT4G14723	37 / 0.0006	EPFL4, CLL2	epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein
AT3G22820	36 / 0.001	EPFL5, CLL1	epidermal patterning factor like 5, CHALLAH-LIKE 1, allergen-related (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.013G136100 [exp]	222 / 1e-76	AT2G20875	118 / 2e-35	epidermal patterning factor 1 (.1)
Potri.011G123000 [exp]	101 / 1e-28	AT2G20875	88 / 2e-23	epidermal patterning factor 1 (.1)
Potri.013G116600 [exp]	72 / 1e-17	AT1G34245	102 / 2e-29	EPIDERMAL PATTERNING FACTOR 2, Putative membrane lipoprotein (.1)
Potri.013G155500 [exp]	44 / 3e-06	AT2G30370	93 / 7e-25	EPF1-like 6, CHALLAH, allergen-related (.1.2)
Potri.019G128200 [exp]	40 / 5e-05	AT2G30370	110 / 7e-32	EPF1-like 6, CHALLAH, allergen-related (.1.2)
Potri.008G157300 [exp]	38 / 0.0003	AT4G14723	69 / 4e-16	epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein

Flax homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10018576 [exp]	129 / 8e-40	AT2G20875	120 / 2e-36	epidermal patterning factor 1 (.1)
Lus10039807 [exp]	52 / 4e-10	ND	53 / 6e-11
Lus10024189 [exp]	41 / 2e-05	ND	107 / 4e-31

PFAM info

Representative CDS sequence

Show only first row Show all

>Potri.019G102800.1 pacid=42774673 polypeptide=Potri.019G102800.1.p locus=Potri.019G102800 ID=Potri.019G102800.1.v4.1 annot-version=v4.1

ATGAAGATTTTTGTTGCAGCATTAGTCATTGCTCTCATTTGTCTTCCCACGGCCATTTCCGCGAGGCACATAGGCAGGCCACGAACACACCATGGGCACC

ACCATTCGACACAGCCTCGAATTAAAGATGGGACGGTGGCACAACCCAATTTCTACAGGGAAAGATGGCCAGCAAAGAGAAGGGGTGATACTGTCCAAAT

TGCTGGATCAAGCTTGCCTGATTGTTCTCATGCATGTGGGTCATGCTCACCATGTAGACTAGTAATGGTCAGCTTTATTTGTGCTTCACTTGAAGAGGCT

GAGACCTGTCCCATGGCTTATAAATGCATGTGTCATAACAAGTCTTATCCTGTCCCATGA

AA sequence

Show only first row Show all

>Potri.019G102800.1 pacid=42774673 polypeptide=Potri.019G102800.1.p locus=Potri.019G102800 ID=Potri.019G102800.1.v4.1 annot-version=v4.1

MKIFVAALVIALICLPTAISARHIGRPRTHHGHHHSTQPRIKDGTVAQPNFYRERWPAKRRGDTVQIAGSSLPDCSHACGSCSPCRLVMVSFICASLEEA

ETCPMAYKCMCHNKSYPVP

DESeq2's median of ratios [POPLAR]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20875		EPF1	epidermal patterning factor 1 ...		Potri.019G102800 [exp]	0	1

Potri.019G102800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.