Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) AT1G29100 133 / 1e-40 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 113 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 107 / 2e-30 Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 97 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 89 / 3e-23 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 88 / 9e-23 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 85 / 1e-21 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 82 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 79 / 4e-19 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G107500 [exp] 302 / 2e-107 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G065600 [exp] 189 / 6e-63 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G056800 [exp] 162 / 3e-52 AT1G06330 147 / 4e-46 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 134 / 6e-41 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G452400 [exp] 112 / 3e-32 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G149500 [exp] 110 / 2e-31 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G110400 [exp] 92 / 2e-24 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 90 / 2e-23 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 90 / 2e-23 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020704 [exp] 207 / 8e-70 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1) Lus10013911 [exp] 108 / 2e-30 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) Lus10001892 [exp] 103 / 8e-29 AT1G06330 101 / 1e-27 Heavy metal transport/detoxification superfamily protein (.1) Lus10033250 [exp] 104 / 1e-28 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1) Lus10008284 [exp] 101 / 1e-27 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1) Lus10027470 [exp] 94 / 3e-25 AT3G48970 167 / 2e-54 Heavy metal transport/detoxification superfamily protein (.1) Lus10014120 [exp] 92 / 4e-24 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10019789 [exp] 91 / 7e-24 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10010147 [exp] 91 / 3e-23 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 87 / 3e-22 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.019G106500.2 pacid=42774509 polypeptide=Potri.019G106500.2.p locus=Potri.019G106500 ID=Potri.019G106500.2.v4.1 annot-version=v4.1 ATGGCGTCAATCATAGAAATGAGAGTGCATATGGATTGTGCTGGATGCGAGAGCAAGGTGAAAAATGCTCTGGAAAAAGTCAAAGGCGTAGATGACATAG ATATAGATATGGGGTTGCAAAAGGTGACGGTCACAGGATGGGCTGACCAAAAGAAGGTTCTTAAGACAGTTCGTAAGACAGGAAGAAGGGCTGAGCTCTG GCAATTACCTTACAATCCACAACATCATAGCTATTCTGACCATTACTACAACCAACACCAAGTTAACGGTCCACTTACTTACCATGCTCCTCAGCCTTCC TCTTCTTACAATTACTACAAGCATGGATATGATAGCAACGATCATGGTTATTATCATCATCCTGTGCATTCCTCCATCTTTAACCACCAGACAGGAGCAG TTTTCAGCGATGAAAACCCTCATGGTTGTTCTATAATGTGA
AA sequence Show only first row Show all	>Potri.019G106500.2 pacid=42774509 polypeptide=Potri.019G106500.2.p locus=Potri.019G106500 ID=Potri.019G106500.2.v4.1 annot-version=v4.1 MASIIEMRVHMDCAGCESKVKNALEKVKGVDDIDIDMGLQKVTVTGWADQKKVLKTVRKTGRRAELWQLPYNPQHHSYSDHYYNQHQVNGPLTYHAPQPS SSYNYYKHGYDSNDHGYYHHPVHSSIFNHQTGAVFSDENPHGCSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G06330			Heavy metal transport/detoxifi...		Potri.019G106500 [exp]	0	1
AT1G06330			Heavy metal transport/detoxifi...		Potri.019G107500 [exp]	4.89	0.9344
AT3G51930			Transducin/WD40 repeat-like su...		Potri.001G022900 [exp]	14.49	0.8031
AT5G54370			Late embryogenesis abundant (L...		Potri.012G145400 [exp]	15.23	0.8929
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Potri.012G092200 [exp]	17.60	0.8673
AT1G50720			Stigma-specific Stig1 family p...		Potri.001G356600 [exp]	22.31	0.8661
AT5G44640		BGLU13	beta glucosidase 13 (.1)		Potri.003G211100 [exp]	28.80	0.8413
AT5G06905		CYP712A2	"cytochrome P450, family 712, ...		Potri.006G058100 [exp]	32.17	0.8456	Pt-CYP712.3
AT3G18230			Octicosapeptide/Phox/Bem1p fam...		Potri.012G053500 [exp]	36.08	0.8496
AT5G06905		CYP712A2	"cytochrome P450, family 712, ...		Potri.016G050200 [exp]	36.55	0.8467	CYP712.2
					Potri.007G081650 [exp]	39.87	0.7880

Compare expression of checked genes

Potri.019G106500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.