Potri.019G107400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03500 71 / 3e-14 Ankyrin repeat family protein (.1)
AT4G03450 62 / 4e-11 Ankyrin repeat family protein (.1)
AT4G03480 58 / 1e-09 Ankyrin repeat family protein (.1)
AT5G50140 57 / 2e-09 Ankyrin repeat family protein (.1)
AT1G03670 56 / 4e-09 ankyrin repeat family protein (.1)
AT4G03460 56 / 4e-09 Ankyrin repeat family protein (.1)
AT3G09550 53 / 4e-08 Ankyrin repeat family protein (.1)
AT4G03490 53 / 6e-08 Ankyrin repeat family protein (.1.2)
AT5G02620 50 / 4e-07 ATANK1, ANK1 ankyrin-like1 (.1)
AT4G03440 47 / 3e-06 Ankyrin repeat family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G108501 356 / 1e-125 AT4G03500 87 / 4e-19 Ankyrin repeat family protein (.1)
Potri.019G109150 348 / 1e-119 AT4G03500 83 / 1e-16 Ankyrin repeat family protein (.1)
Potri.019G108200 334 / 1e-112 AT4G03500 114 / 2e-26 Ankyrin repeat family protein (.1)
Potri.019G108801 327 / 2e-112 AT4G03500 101 / 4e-23 Ankyrin repeat family protein (.1)
Potri.019G107700 332 / 3e-112 AT4G03500 129 / 2e-31 Ankyrin repeat family protein (.1)
Potri.019G106000 327 / 5e-110 AT4G03460 109 / 8e-25 Ankyrin repeat family protein (.1)
Potri.019G107800 322 / 4e-108 AT4G03500 129 / 2e-31 Ankyrin repeat family protein (.1)
Potri.019G105900 322 / 5e-108 AT4G03500 129 / 2e-31 Ankyrin repeat family protein (.1)
Potri.019G108000 301 / 1e-99 AT4G03500 126 / 3e-30 Ankyrin repeat family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020209 89 / 4e-20 AT1G03670 175 / 6e-47 ankyrin repeat family protein (.1)
Lus10013877 77 / 4e-18 ND /
Lus10015037 52 / 7e-08 AT3G09550 849 / 0.0 Ankyrin repeat family protein (.1)
Lus10003986 50 / 3e-07 AT3G09550 831 / 0.0 Ankyrin repeat family protein (.1)
Lus10022330 47 / 4e-06 AT3G01750 633 / 0.0 Ankyrin repeat family protein (.1)
Lus10003308 46 / 1e-05 AT3G12360 981 / 0.0 INCREASED TOLERANCE TO NACL, Ankyrin repeat family protein (.1)
Lus10038609 44 / 3e-05 AT1G10340 142 / 2e-38 Ankyrin repeat family protein (.1.2)
Lus10037894 44 / 5e-05 AT1G10340 298 / 3e-93 Ankyrin repeat family protein (.1.2)
Lus10023460 44 / 5e-05 AT3G12360 929 / 0.0 INCREASED TOLERANCE TO NACL, Ankyrin repeat family protein (.1)
Lus10021508 43 / 7e-05 AT3G09890 209 / 5e-69 Ankyrin repeat family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0465 Ank PF12796 Ank_2 Ankyrin repeats (3 copies)
Representative CDS sequence
>Potri.019G107400.1 pacid=42773023 polypeptide=Potri.019G107400.1.p locus=Potri.019G107400 ID=Potri.019G107400.1.v4.1 annot-version=v4.1
ATGACGACCTATATGGATCCTGTCTTGTTCAAAGCTGCAGAAGCAGGCAATATCGGTCCCTTTGAGAATGATCAAACCTGCCTCAATCAGTTATTCACTC
CAGACGAGAACACCATTCTTCATGTCTGCTTAGGAAACCAAAGCAGTGAACCGGAATCCACTTATTTTGTTGATAAAATTCTTGAAATGTGTCCACCACT
ATTATTGCAGGCCAATAAGAAAGGTGAAATCCCACTCCATTTGGCAGCAAGATATGGGCATTCCAACGTGGTAAGAGTCCTCATTGACCGCGCCAGAGCT
CGACCTACTGATCCAGAGAGCGGAGTAACAGAAGCAAAAAAGATGTTGAGGATGACCAATGTAGAGCAAGATACAGCGTTGCACGAGGCAGCTCGAAATA
GGCGGGGCCACGTGGTGGAAATATTGACTAAAGAGGACCCATATTTTTCATATTCCGCCAATGTTCATGAAGAAACTCCACTTTATATTGCTGCTTCCAT
TGTCTCGAGGCCGAGCAAAGAACTTAGAAAGGTAGTCAATGAAATCTTAAGAAATTGCATCTCAGTGGACTACGGCGGCCCTAATGGTAGAACTGCTCTA
CACGGGTCCAGCGCGGTGGGAGATCATGGTAGGATTTTGTGCTCGAGTCTGGAGAATTAA
AA sequence
>Potri.019G107400.1 pacid=42773023 polypeptide=Potri.019G107400.1.p locus=Potri.019G107400 ID=Potri.019G107400.1.v4.1 annot-version=v4.1
MTTYMDPVLFKAAEAGNIGPFENDQTCLNQLFTPDENTILHVCLGNQSSEPESTYFVDKILEMCPPLLLQANKKGEIPLHLAARYGHSNVVRVLIDRARA
RPTDPESGVTEAKKMLRMTNVEQDTALHEAARNRRGHVVEILTKEDPYFSYSANVHEETPLYIAASIVSRPSKELRKVVNEILRNCISVDYGGPNGRTAL
HGSSAVGDHGRILCSSLEN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G03500 Ankyrin repeat family protein ... Potri.019G107400 0 1
AT1G34050 Ankyrin repeat family protein ... Potri.001G444300 2.00 0.9674
AT1G34050 Ankyrin repeat family protein ... Potri.001G443600 4.24 0.9390
AT4G34480 O-Glycosyl hydrolases family 1... Potri.004G153800 5.09 0.9147
Potri.014G115800 6.32 0.9294
AT1G60420 DC1 domain-containing protein ... Potri.010G059401 9.48 0.9124
AT2G24600 Ankyrin repeat family protein ... Potri.014G050532 9.59 0.9534
Potri.002G190900 9.94 0.9284
AT4G03500 Ankyrin repeat family protein ... Potri.019G109150 13.22 0.8908
AT4G13440 Calcium-binding EF-hand family... Potri.019G029000 13.74 0.8877
AT5G10770 Eukaryotic aspartyl protease f... Potri.018G014600 14.38 0.8957

Potri.019G107400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.