Potri.019G108800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03320 284 / 1e-95 AtTic20-IV, TIC20-IV translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
AT1G04940 189 / 2e-58 AtTic20-I, atTIC20, TIC20 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
AT1G04945 170 / 4e-48 HIT-type Zinc finger family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G031800 199 / 2e-62 AT1G04940 363 / 1e-127 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Potri.005G231400 190 / 5e-59 AT1G04940 360 / 2e-126 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039783 311 / 3e-106 AT4G03320 263 / 1e-87 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Lus10010636 172 / 6e-52 AT1G04940 338 / 9e-118 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Lus10033195 170 / 2e-51 AT1G04940 341 / 7e-119 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF16166 TIC20 Chloroplast import apparatus Tic20-like
Representative CDS sequence
>Potri.019G108800.1 pacid=42773976 polypeptide=Potri.019G108800.1.p locus=Potri.019G108800 ID=Potri.019G108800.1.v4.1 annot-version=v4.1
ATGTCCGCCACCGCAACCGCAGCCCAACACTTGTCAAAGACTTCTCCGCTTCTCGCTCCTGCCGTCGTCGCTGCGTATGCTGCTTACCGATATAAGAGTG
AGCTTGCAGATGGATGTCAGGAGATCGTAGGGGCTAATAAGCCCTTCTCAAGTAGCTCCAGTGTAGCGTGTGAATCTAACTTGCCTGAATGGCCTACTTT
GTCGATCAGCAGAAGCTCACGTTTCAGATCTCATCAACAGCTGCCTTGCTGGTCTTCTAAAGAGAACACAATGTCACATGTTTTGCCTGCGCACTCTTCA
ATGTTTGGAGACATCGAAGGTTTATTAGATACAATACCCTGGTCACCTGCACAGCGAAGATCCATAACGCCCCCCAGAGCAATGCATAAGAACGAACTTT
TTGGTTTTCGCTACCCTGTATTAGCTGAGAAGCCTGAATGGTGGTGGAGAACGCTGGCATGTGTCCCTTATTTGATTGCTTTGCAAATATCAGATACAGG
ATATTTCATCCAACCCTTCCTTGAACACTACGATGTCCTTGGAGATTTGATATACTTTGTACCAGGAGCGATCACGAGATTACCTGTCTGGTTCTCTATG
ATATATTGCTACTTTGCTTACATTGGGATCGTGAAGAACAAAGATGTGCCTCACTTCTTTAGGTTCCATCTGATGATGGGCATGCTATTGGAAACAGGCC
TACAGATCTTGTGGTATACAAGTAATTTCTTTCCTCTCATACACTATAATGGTATGTTTGGGATGCATTACTGGGCAGGCGTGGGACTTGCCTACATTGT
GATCTTGTTGCAGTGTGTAAGGTGTGCTCTTGCAGGCGGTTATGCTCACCTCCCTCTTGTTAGTGATGCTGCATATATTCATACTTTGTTTAACATAGGA
GGGTACCAACGACCTTTCTAG
AA sequence
>Potri.019G108800.1 pacid=42773976 polypeptide=Potri.019G108800.1.p locus=Potri.019G108800 ID=Potri.019G108800.1.v4.1 annot-version=v4.1
MSATATAAQHLSKTSPLLAPAVVAAYAAYRYKSELADGCQEIVGANKPFSSSSSVACESNLPEWPTLSISRSSRFRSHQQLPCWSSKENTMSHVLPAHSS
MFGDIEGLLDTIPWSPAQRRSITPPRAMHKNELFGFRYPVLAEKPEWWWRTLACVPYLIALQISDTGYFIQPFLEHYDVLGDLIYFVPGAITRLPVWFSM
IYCYFAYIGIVKNKDVPHFFRFHLMMGMLLETGLQILWYTSNFFPLIHYNGMFGMHYWAGVGLAYIVILLQCVRCALAGGYAHLPLVSDAAYIHTLFNIG
GYQRPF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G03320 AtTic20-IV, TIC... translocon at the inner envelo... Potri.019G108800 0 1
AT5G22480 ZPR1 zinc-finger domain protei... Potri.004G075600 2.44 0.9450
AT1G53540 HSP20-like chaperones superfam... Potri.010G175200 4.24 0.9262 Pt-HSP17.8
AT3G50930 BCS1 cytochrome BC1 synthesis (.1) Potri.002G032700 6.00 0.9240
AT5G07330 unknown protein Potri.012G111000 7.21 0.9213
AT1G02700 unknown protein Potri.014G124500 9.79 0.9416
AT5G53400 BOB1, BOBBER1 BOBBER1, HSP20-like chaperones... Potri.015G013900 10.81 0.8928
AT3G22830 HSF AT-HSFA6B ARABIDOPSIS THALIANA HEAT SHOC... Potri.008G157600 11.18 0.9084 Pt-HSFA6.2
AT3G07150 unknown protein Potri.002G244400 11.22 0.9109
AT2G29500 HSP20-like chaperones superfam... Potri.001G254700 12.48 0.9387
AT5G37670 HSP15.7CI HSP20-like chaperones superfam... Potri.017G130700 17.46 0.9352

Potri.019G108800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.