Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ATHM1.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G03520 172 / 9e-55 ATHM2 Thioredoxin superfamily protein (.1.2) AT3G15360 169 / 3e-53 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT1G03680 162 / 1e-50 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT2G15570 111 / 5e-31 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT1G76760 87 / 1e-21 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G43560 81 / 3e-19 ATY2 thioredoxin Y2 (.1) AT1G50320 76 / 5e-17 ATHX, ATX thioredoxin X (.1) AT3G51030 66 / 3e-14 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT4G12170 65 / 1e-13 Thioredoxin superfamily protein (.1) AT2G35010 66 / 2e-13 ATO1 thioredoxin O1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G132200 [exp] 284 / 1e-98 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 191 / 3e-62 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.011G120700 [exp] 183 / 6e-59 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.005G058400 [exp] 154 / 1e-47 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 153 / 4e-47 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.005G186800 [exp] 149 / 8e-46 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.009G100700 [exp] 127 / 4e-37 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Potri.002G066800 [exp] 83 / 6e-20 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1) Potri.005G193400 [exp] 81 / 3e-19 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014798 [exp] 176 / 2e-56 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 175 / 5e-56 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 154 / 1e-47 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 153 / 2e-47 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 153 / 3e-47 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014069 [exp] 114 / 4e-32 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10019847 [exp] 113 / 1e-31 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10018875 [exp] 78 / 4e-18 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10028569 [exp] 77 / 1e-17 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10022727 [exp] 65 / 2e-13 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF13098 [poplar] [flax] Thioredoxin_2 Thioredoxin-like domain
Representative CDS sequence Show only first row Show all	>Potri.019G111200.1 pacid=42773484 polypeptide=Potri.019G111200.1.p locus=Potri.019G111200 ID=Potri.019G111200.1.v4.1 annot-version=v4.1 ATGGACTCATCGATGGCTTTATCTTCTTACTCTTCACGCCTAAAATGCTCCCTCCCTAATCCCCCGCCTATGATGATGGTGCCGTCACCTCAGCTCCCAG GTGTGCTTCCTTTATCCAGCCGCCGTTGTGGCATAGCTTCCTTTGCGGAGTTCAGAGGATTGAGGATGCAAATGGGTTCAAAATTGTCAACTTCGTTGGT TTCGATTAGAACGAGAAGAAATCCTAAGGTTTTTTCTCGTATTGTGTCTGAAGCTCATGAGACTTTTGTTGATATTCCTGCAGTGACGGATGAAACATGG CAGTCGCTCATCATCGAGGCTGATGGACCCGTGCTGGTTGAGTTCTGGGCTCCGTGGTGTGGACCCTGCCGGATAATCCATCCAGTAATAGCTGAACTAT CTACGGAATATGATGGAAAGCTCAAGTGCTTCAAATTGAATACTGATGAAAGTCCTTCTACCACAACCAAGTATGGAATTCGAAGCATCCCTACAATCAT GATCTTCAAAAACGGGGAGAAGAAAGATGCAATTATTGGTTCTGTGCCTAAAACCACACTAATTTCCAATATGAAGAAATTCTTATAG
AA sequence Show only first row Show all	>Potri.019G111200.1 pacid=42773484 polypeptide=Potri.019G111200.1.p locus=Potri.019G111200 ID=Potri.019G111200.1.v4.1 annot-version=v4.1 MDSSMALSSYSSRLKCSLPNPPPMMMVPSPQLPGVLPLSSRRCGIASFAEFRGLRMQMGSKLSTSLVSIRTRRNPKVFSRIVSEAHETFVDIPAVTDETW QSLIIEADGPVLVEFWAPWCGPCRIIHPVIAELSTEYDGKLKCFKLNTDESPSTTTKYGIRSIPTIMIFKNGEKKDAIIGSVPKTTLISNMKKFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G03520		ATHM2	Thioredoxin superfamily protei...		Potri.019G111200 [exp]	0	1	Pt-ATHM1.3
AT1G05620		NSH2, URH2	nucleoside hydrolase 2, uridin...		Potri.007G144600 [exp]	3.87	0.8382
AT4G04210		PUX4	plant UBX domain containing pr...		Potri.011G005000 [exp]	7.07	0.8216
AT2G42780			unknown protein		Potri.012G059000 [exp]	11.83	0.7619
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Potri.008G080700 [exp]	16.49	0.7800
					Potri.013G057766 [exp]	16.61	0.7557
AT1G59900		AT-E1 ALPHA, AT...	pyruvate dehydrogenase complex...		Potri.008G192500 [exp]	27.23	0.7517	ALPHA.9
AT2G28430			unknown protein		Potri.004G210800 [exp]	27.34	0.7728
AT4G27120			unknown protein		Potri.001G418900 [exp]	32.49	0.7873
AT3G04830			Protein prenylyltransferase su...		Potri.005G051300 [exp]	38.10	0.7629
AT1G01490			Heavy metal transport/detoxifi...		Potri.017G145516 [exp]	42.98	0.7503

Compare expression of checked genes

Potri.019G111200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.