Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05710 179 / 5e-59 bHLH bHLH153 basic helix-loop-helix (bHLH) DNA-binding superfamily protein AT2G31730 170 / 3e-55 bHLH basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) AT3G19500 120 / 3e-34 bHLH bHLH113 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) AT1G61660 110 / 1e-29 bHLH bHLH112 basic helix-loop-helix (bHLH) DNA-binding superfamily protein AT3G20640 108 / 1e-28 bHLH bHLH123 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) AT2G20100 100 / 6e-26 bHLH basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) AT4G29100 99 / 4e-25 bHLH bHLH068 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) AT1G49830 95 / 1e-24 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) AT1G31050 96 / 4e-24 bHLH bHLH111 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) AT1G27660 94 / 2e-23 bHLH bHLH110 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G126800 [exp] 273 / 7e-96 AT1G05710 192 / 4e-64 basic helix-loop-helix (bHLH) DNA-binding superfamily protein Potri.009G094300 [exp] 119 / 5e-34 AT3G19500 161 / 2e-48 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.001G299300 [exp] 113 / 1e-31 AT3G19500 152 / 4e-45 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.011G033000 [exp] 116 / 2e-31 AT1G61660 216 / 2e-65 basic helix-loop-helix (bHLH) DNA-binding superfamily protein Potri.004G029100 [exp] 115 / 5e-31 AT1G61660 216 / 1e-65 basic helix-loop-helix (bHLH) DNA-binding superfamily protein Potri.003G051600 [exp] 109 / 1e-29 AT4G29100 197 / 4e-60 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.001G185900 [exp] 109 / 1e-29 AT4G29100 212 / 5e-66 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.011G129500 [exp] 109 / 5e-29 AT3G20640 289 / 3e-93 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.001G410600 [exp] 108 / 1e-28 AT3G20640 274 / 2e-87 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027064 [exp] 209 / 5e-71 AT1G05710 174 / 9e-57 basic helix-loop-helix (bHLH) DNA-binding superfamily protein Lus10025599 [exp] 205 / 4e-69 AT1G05710 169 / 8e-55 basic helix-loop-helix (bHLH) DNA-binding superfamily protein Lus10013874 [exp] 122 / 2e-34 AT3G19500 151 / 7e-44 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Lus10041649 [exp] 120 / 4e-34 AT2G31730 117 / 2e-32 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Lus10007613 [exp] 119 / 2e-33 AT1G61660 194 / 1e-58 basic helix-loop-helix (bHLH) DNA-binding superfamily protein Lus10018400 [exp] 119 / 2e-33 AT1G61660 195 / 3e-59 basic helix-loop-helix (bHLH) DNA-binding superfamily protein Lus10038550 [exp] 109 / 9e-29 AT3G20640 231 / 4e-70 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Lus10024071 [exp] 102 / 1e-28 AT2G31730 116 / 3e-34 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Lus10023669 [exp] 103 / 8e-27 AT2G20100 223 / 5e-69 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10010638 [exp] 100 / 1e-25 AT1G27660 180 / 1e-51 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G112000.1 pacid=42774742 polypeptide=Potri.019G112000.1.p locus=Potri.019G112000 ID=Potri.019G112000.1.v4.1 annot-version=v4.1 ATGATGGAAAACAAGAGAAGCCCTTGCTCAGTTGACCATGGCACTCTCACTTCTCTTGCAACTAAAAGACACAAGGCTGATTTTTCTATCTCCACCAAGG AACGAAAAGAGAAACTTGGGGAACGCATCGTAGCTCTGCAGCAGCTTGTTTCACCGTATGGAAAGACTGATACTGCATCTGTCCTTATGGAGGCGATGGA ATACATACGGTTCCTTCATGAACAAGTTCAGGTGTTGAGTGCTCCATACCTCCAAGGTACATCGACAGCACAAATGCAGGGGTTAGGGCAACACAGTCTA GAAAGCAAAGGTTTATGTCTTGTACCAATCTCTTACACTGCAGGCATTGCTCGTAGCAATGGTGCAGATATCTGGGCCCCCATCAAGAGCCCTTCTCCCA AATGTAACAAGTCTATTTCACAATTTCATTGA
AA sequence Show only first row Show all	>Potri.019G112000.1 pacid=42774742 polypeptide=Potri.019G112000.1.p locus=Potri.019G112000 ID=Potri.019G112000.1.v4.1 annot-version=v4.1 MMENKRSPCSVDHGTLTSLATKRHKADFSISTKERKEKLGERIVALQQLVSPYGKTDTASVLMEAMEYIRFLHEQVQVLSAPYLQGTSTAQMQGLGQHSL ESKGLCLVPISYTAGIARSNGADIWAPIKSPSPKCNKSISQFH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05710	bHLH	bHLH153	basic helix-loop-helix (bHLH) ...		Potri.019G112000 [exp]	0	1
AT1G76890	Trihelix	AT-GT2, GT2	Duplicated homeodomain-like su...		Potri.005G191900 [exp]	4.12	0.8195	Pt-GT2.2
AT5G45550		MOB1-like	MOB1-like, Mob1/phocein family...		Potri.006G142500 [exp]	10.39	0.7147
AT1G55730		ATCAX5	cation exchanger 5 (.1.2)		Potri.010G249200 [exp]	10.95	0.7910
AT4G14950		KMS1	Killing Me Slowly 1, SNARE ass...		Potri.008G151300 [exp]	12.24	0.7338
AT2G18360			alpha/beta-Hydrolases superfam...		Potri.004G155700 [exp]	15.03	0.8030
AT5G57850			D-aminoacid aminotransferase-l...		Potri.018G039000 [exp]	15.65	0.7729
AT3G14840			Leucine-rich repeat transmembr...		Potri.001G385200 [exp]	16.43	0.7863
AT3G14470			NB-ARC domain-containing disea...		Potri.014G012000 [exp]	17.88	0.7637
					Potri.017G008901 [exp]	26.07	0.7542
AT2G39710			Eukaryotic aspartyl protease f...		Potri.008G058000 [exp]	27.98	0.7665

Compare expression of checked genes

Potri.019G112000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.