Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) AT4G10265 105 / 3e-31 Wound-responsive family protein (.1) AT4G33560 58 / 1e-12 Wound-responsive family protein (.1) AT2G14070 53 / 1e-09 wound-responsive protein-related (.1) AT4G05070 39 / 2e-05 Wound-responsive family protein (.1) AT4G28240 35 / 0.0007 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G148000 [exp] 146 / 2e-47 AT4G10270 101 / 7e-30 Wound-responsive family protein (.1) Potri.013G148100 [exp] 144 / 1e-46 AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) Potri.019G116600 [exp] 132 / 7e-42 AT4G10270 82 / 4e-22 Wound-responsive family protein (.1) Potri.019G116800 [exp] 132 / 8e-42 AT4G10270 95 / 3e-27 Wound-responsive family protein (.1) Potri.019G117201 [exp] 129 / 8e-41 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117402 [exp] 129 / 1e-40 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 129 / 1e-40 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117632 [exp] 128 / 2e-40 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G116866 [exp] 127 / 4e-40 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039755 [exp] 122 / 7e-38 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 117 / 4e-36 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039751 [exp] 110 / 2e-33 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039760 [exp] 110 / 2e-33 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10018532 [exp] 110 / 4e-33 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039752 [exp] 106 / 1e-31 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1) Lus10018530 [exp] 106 / 1e-31 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10039753 [exp] 105 / 3e-31 AT4G10265 120 / 4e-37 Wound-responsive family protein (.1) Lus10039761 [exp] 103 / 1e-30 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039754 [exp] 103 / 1e-30 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [poplar] [flax] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Potri.019G116500.1 pacid=42773491 polypeptide=Potri.019G116500.1.p locus=Potri.019G116500 ID=Potri.019G116500.1.v4.1 annot-version=v4.1 ATGAGTTCAACAAGCAAAGCTTGGATGGTAGCCTTTGGTATTGCAGCTGTGGAGGCAATGAAAGATCAAGGGTTTTGCAGATGGAACTACACAATTAGAT TATTACACCATCATGCCAAGAACAAAGTTAGGTCAATGTCTAAGGCCAAGAAGCTGTCTTCTCCGACTTCTAACGTGGTTTCAAGTAAAGTAAGAGAAAA TCAGAAGGCAAAGCAATCAGAGGAGTCACTAAGGACCGTCATGTACTTAAGTTGTTGGGGTCCCTACTGA
AA sequence Show only first row Show all	>Potri.019G116500.1 pacid=42773491 polypeptide=Potri.019G116500.1.p locus=Potri.019G116500 ID=Potri.019G116500.1.v4.1 annot-version=v4.1 MSSTSKAWMVAFGIAAVEAMKDQGFCRWNYTIRLLHHHAKNKVRSMSKAKKLSSPTSNVVSSKVRENQKAKQSEESLRTVMYLSCWGPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10270			Wound-responsive family protei...		Potri.019G116500 [exp]	0	1
					Potri.007G126750 [exp]	2.00	0.9155
AT1G58420			Uncharacterised conserved prot...		Potri.002G117100 [exp]	2.00	0.9354
AT5G62520		SRO5	similar to RCD one 5 (.1.2)		Potri.012G081100 [exp]	2.23	0.9117
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Potri.002G154200 [exp]	2.64	0.8836	NAC087
AT5G54165			unknown protein		Potri.012G021602 [exp]	3.00	0.9258
AT1G73010		AtPPsPase1, ATP...	pyrophosphate-specific phospha...		Potri.008G196800 [exp]	6.00	0.8706
AT4G05070			Wound-responsive family protei...		Potri.004G033300 [exp]	6.78	0.8490
AT1G15400			unknown protein		Potri.001G172100 [exp]	7.93	0.8543
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Potri.002G182400 [exp]	9.48	0.8364
					Potri.004G147966 [exp]	14.28	0.8883

Compare expression of checked genes

Potri.019G116500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.