Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10270 50 / 9e-10 Wound-responsive family protein (.1) AT4G10265 45 / 3e-08 Wound-responsive family protein (.1) AT4G05070 37 / 0.0001 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G116600 [exp] 67 / 2e-16 AT4G10270 82 / 4e-22 Wound-responsive family protein (.1) Potri.019G116500 [exp] 59 / 1e-13 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.013G148100 [exp] 59 / 2e-13 AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) Potri.019G116932 [exp] 59 / 2e-13 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 59 / 2e-13 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117201 [exp] 57 / 8e-13 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.013G148000 [exp] 57 / 8e-13 AT4G10270 101 / 7e-30 Wound-responsive family protein (.1) Potri.019G117200 [exp] 56 / 2e-12 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.019G116866 [exp] 56 / 4e-12 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039755 [exp] 56 / 3e-12 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 53 / 4e-11 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10033729 [exp] 52 / 2e-10 AT4G10270 94 / 8e-27 Wound-responsive family protein (.1) Lus10039751 [exp] 51 / 4e-10 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039753 [exp] 50 / 9e-10 AT4G10265 120 / 4e-37 Wound-responsive family protein (.1) Lus10039760 [exp] 50 / 1e-09 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10018532 [exp] 50 / 1e-09 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039752 [exp] 48 / 4e-09 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1) Lus10018530 [exp] 47 / 7e-09 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10039761 [exp] 45 / 1e-07 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [poplar] [flax] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Potri.019G116700.1 pacid=42774713 polypeptide=Potri.019G116700.1.p locus=Potri.019G116700 ID=Potri.019G116700.1.v4.1 annot-version=v4.1 ATGATTTCAGCAAGATCGTTCCATCAGAATGCCAAGAACCAAGTCAAGTCAATCTCTCAGGCCAAGAAGCTGTCTTCTCCAACTTCTAGTACTGTGGTTT CAAGTAAAGTAAAAGAAAATCAGAAAGCAACGCAAGCAGAGGAGTCCCTGAGGAGAGTCATGTACTTGAGTTGCTGGGGTCCTTACTAG
AA sequence Show only first row Show all	>Potri.019G116700.1 pacid=42774713 polypeptide=Potri.019G116700.1.p locus=Potri.019G116700 ID=Potri.019G116700.1.v4.1 annot-version=v4.1 MISARSFHQNAKNQVKSISQAKKLSSPTSSTVVSSKVKENQKATQAEESLRRVMYLSCWGPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10270			Wound-responsive family protei...		Potri.019G116700 [exp]	0	1
AT2G15890		MEE14	maternal effect embryo arrest ...		Potri.009G108200 [exp]	3.60	0.9056
AT5G37930			Protein with RING/U-box and TR...		Potri.004G072800 [exp]	3.60	0.9401
AT2G42760			unknown protein		Potri.011G069900 [exp]	5.19	0.9245
					Potri.001G035450 [exp]	6.92	0.9165
AT4G21190		EMB1417	embryo defective 1417, Pentatr...		Potri.017G148700 [exp]	10.19	0.9275
AT1G53920		GLIP5	GDSL-motif lipase 5 (.1)		Potri.018G063901 [exp]	11.53	0.9221
AT4G35750			SEC14 cytosolic factor family ...		Potri.002G014700 [exp]	12.24	0.8743
AT4G07990			Chaperone DnaJ-domain superfam...		Potri.002G114600 [exp]	14.83	0.8991
AT2G13690			PRLI-interacting factor, putat...		Potri.007G109300 [exp]	17.54	0.8986
AT5G67140			F-box/RNI-like superfamily pro...		Potri.007G045601 [exp]	21.14	0.8548

Compare expression of checked genes

Potri.019G116700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.