Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G03230 162 / 3e-45 S-locus lectin protein kinase family protein (.1) AT1G11340 55 / 2e-08 S-locus lectin protein kinase family protein (.1) AT3G53840 54 / 5e-08 Protein kinase superfamily protein (.1) AT1G11300 52 / 3e-07 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT1G11410 49 / 2e-06 S-locus lectin protein kinase family protein (.1) AT1G11330 48 / 4e-06 S-locus lectin protein kinase family protein (.1.2) AT1G61390 47 / 8e-06 S-locus lectin protein kinase family protein (.1.2) AT1G11280 46 / 2e-05 S-locus lectin protein kinase family protein (.1.2.3.4) AT1G61380 44 / 7e-05 SD1-29 S-domain-1 29 (.1) AT4G27290 44 / 7e-05 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G119700 [exp] 419 / 3e-140 AT4G03230 1025 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119900 [exp] 410 / 1e-136 AT4G03230 974 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119600 [exp] 409 / 3e-136 AT4G03230 983 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.013G150800 [exp] 206 / 2e-60 AT4G03230 1206 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G120000 [exp] 181 / 6e-52 AT4G03230 967 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.008G059900 [exp] 71 / 1e-13 AT5G02070 628 / 0.0 Protein kinase family protein (.1) Potri.006G118500 [exp] 62 / 7e-11 AT5G02070 577 / 0.0 Protein kinase family protein (.1) Potri.010G015800 [exp] 51 / 3e-07 AT4G27290 844 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G027501 [exp] 51 / 3e-07 AT4G23180 553 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031591 [exp] 148 / 3e-40 AT4G03230 853 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018512 [exp] 138 / 9e-37 AT4G03230 823 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033752 [exp] 71 / 7e-14 AT4G03230 497 / 6e-169 S-locus lectin protein kinase family protein (.1) Lus10039725 [exp] 67 / 3e-12 AT4G03230 445 / 5e-144 S-locus lectin protein kinase family protein (.1) Lus10031592 [exp] 67 / 3e-12 AT4G03230 351 / 3e-107 S-locus lectin protein kinase family protein (.1) Lus10025512 [exp] 59 / 1e-09 AT1G11340 530 / 5e-177 S-locus lectin protein kinase family protein (.1) Lus10039731 [exp] 53 / 1e-07 AT1G11300 1112 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10033742 [exp] 52 / 1e-07 AT4G03230 161 / 2e-42 S-locus lectin protein kinase family protein (.1) Lus10013247 [exp] 51 / 5e-07 AT1G11340 402 / 4e-131 S-locus lectin protein kinase family protein (.1) Lus10013245 [exp] 51 / 5e-07 AT1G11300 955 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G119750.1 pacid=42773903 polypeptide=Potri.019G119750.1.p locus=Potri.019G119750 ID=Potri.019G119750.1.v4.1 annot-version=v4.1 ATGTCTGATTCAGACATGATTACGGAGATGCTCTGTAGTTTTTTGAACAGGGGCTTGGTGGGCTTACCGGCAAAAGTCATGTTCAACTATAGTGTCACTA CCATCAATCAAGATACAAGAACATTTGTTATCCAAGAGAAAGATGTAGATGATTGTAATGCCAGTACAAGAGGTCAAATTCGGGAGTTCAACACGTCATT TCCATTTAAGATGAACGCCTCTAAACGCTGGTGTGATACCGTGGCAGGAAATTTTATTTCCAACGCTTCATCTCAAGGTCTGGTAGAAATAGATATTGGT TGGGCGCCACCTCAAGAGCCAGTCTGCTCCTCATCTTCAGACTGCGACGATTGGCCAAATTCAACTTGCAATGTAACAGGAAATGGTACAGCGAGATGCC TCTGCAATTCAGATTTTTGGTGGGATGGCATGGCTCTAAAGTGCGTTCATGTTGTCGATGGACAAGCAGGAGGAAAGAAACCATTGCCTTTGATTGTAGG AGTTGCAATTGCTAGTGTCATAGTTCTATCAAGCATCTTCCTTTACATCTGCATTTTTATGAGAAAGAAGGCCAAACGACGAGAAAGCCAGCAAAATACT GAAAGAAATGCAGCTCTTTTGTATGGCACTGAGAAACGGGTCAAGAACTTGATAGATGCAGAAGAGTTCAAGGAAGAAGATAAGAAGGGCATAGATGTAC CTTTCTTTGATTTAGACAGCATACTAGCTGCTACGGATTATTTTTCAGAAGCAAACAAGCTTGGAAGAGGGGGCTCCGGACCTTGTTAG
AA sequence Show only first row Show all	>Potri.019G119750.1 pacid=42773903 polypeptide=Potri.019G119750.1.p locus=Potri.019G119750 ID=Potri.019G119750.1.v4.1 annot-version=v4.1 MSDSDMITEMLCSFLNRGLVGLPAKVMFNYSVTTINQDTRTFVIQEKDVDDCNASTRGQIREFNTSFPFKMNASKRWCDTVAGNFISNASSQGLVEIDIG WAPPQEPVCSSSSDCDDWPNSTCNVTGNGTARCLCNSDFWWDGMALKCVHVVDGQAGGKKPLPLIVGVAIASVIVLSSIFLYICIFMRKKAKRRESQQNT ERNAALLYGTEKRVKNLIDAEEFKEEDKKGIDVPFFDLDSILAATDYFSEANKLGRGGSGPC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G03230			S-locus lectin protein kinase ...		Potri.019G119750 [exp]	0	1
AT4G03230			S-locus lectin protein kinase ...		Potri.019G119700 [exp]	1.41	0.9737
AT1G60470		ATGOLS4	galactinol synthase 4 (.1)		Potri.010G042000 [exp]	2.44	0.9692
AT3G21750		UGT71B1	UDP-glucosyl transferase 71B1 ...		Potri.016G017002 [exp]	4.00	0.9630
AT5G16340			AMP-dependent synthetase and l...		Potri.013G096200 [exp]	6.24	0.9640
AT5G42760			Leucine carboxyl methyltransfe...		Potri.002G260300 [exp]	10.09	0.9590
AT3G21790			UDP-Glycosyltransferase superf...		Potri.016G016400 [exp]	10.09	0.9468
AT5G19875			unknown protein		Potri.001G231300 [exp]	12.36	0.9542
AT1G07010		AtSLP1	Shewenella-like protein phosph...		Potri.009G077900 [exp]	12.64	0.9538
AT5G24120		ATSIG5, SIG5, S...	SIGMA FACTOR 5, sigma factor E...		Potri.012G031100 [exp]	12.96	0.9552	Pt-SIGE.3
AT1G64500			Glutaredoxin family protein (....		Potri.003G141800 [exp]	13.22	0.9565

Compare expression of checked genes

Potri.019G119750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.