Potri.019G122100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73325 61 / 4e-11 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 40 / 0.0003 ATDR4 drought-repressed 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G124500 416 / 2e-150 AT1G73325 61 / 4e-11 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G124750 296 / 5e-103 AT1G73325 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G124432 293 / 3e-102 AT1G73325 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G124400 288 / 6e-100 AT1G73325 56 / 2e-09 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007922 243 / 2e-82 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007900 243 / 2e-82 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007811 243 / 2e-82 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007700 226 / 2e-75 AT1G73325 62 / 1e-11 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G010111 221 / 2e-73 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007890 57 / 9e-10 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007902 57 / 9e-10 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 54 / 1e-08 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030355 52 / 4e-08 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007888 46 / 2e-06 AT1G17860 125 / 7e-37 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10004223 39 / 0.001 AT1G73260 81 / 1e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Potri.019G122100.1 pacid=42773353 polypeptide=Potri.019G122100.1.p locus=Potri.019G122100 ID=Potri.019G122100.1.v4.1 annot-version=v4.1
ATGAAGATCACCAAGTTTGTAGTGCTCTCCTTTCTTCTCTTTGCCTTCACAGCAACTTCAATATTTCCCCATGCCGTTCATGCCGAAGATCCTGAAGCAG
TGATCGATGTCAACGGTAATGAGGTGACACCTGATGCTCGTTATTTCATCGGAGCCGCTTCGGATGATAATACAACAACTCTTGTGGTCTCTGCGACTAG
CCAGATCATATGCAATTCAGATGTTACACTTTCCTCAATGAGCAATGGGCTCCCAGTAACATTTTCATCACCAGTTGGAGAATCCAACGACGGTGTCATC
CGCGAAGACAGTTATCTGAATGTGAACTTTGATGCAGCCACATGTAGGATGGCGGGCGTATCAACCATGTGGAAGATGGAGTTGAGGCCAACAATGCGAG
GATTCGTTGTGACCACAGGAGGTGTTAATGGATTGAATCGGTTCAAGATCACCAAGTATGAAGGTGGTAAAAATTCGTATCAGCTTTCTTACTGTCCAAT
TTCCGACCCCATGTGCGAATGCTCATGCGCATGCGTCCCACTTGGCAACGTTGTCGATCGCTTGGCTCCCAGCACCATCCCTTTTCCTGTTGTGTTTGAA
CCAGTTGCAGATAAAAGCTCCTGA
AA sequence
>Potri.019G122100.1 pacid=42773353 polypeptide=Potri.019G122100.1.p locus=Potri.019G122100 ID=Potri.019G122100.1.v4.1 annot-version=v4.1
MKITKFVVLSFLLFAFTATSIFPHAVHAEDPEAVIDVNGNEVTPDARYFIGAASDDNTTTLVVSATSQIICNSDVTLSSMSNGLPVTFSSPVGESNDGVI
REDSYLNVNFDAATCRMAGVSTMWKMELRPTMRGFVVTTGGVNGLNRFKITKYEGGKNSYQLSYCPISDPMCECSCACVPLGNVVDRLAPSTIPFPVVFE
PVADKSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G73325 Kunitz family trypsin and prot... Potri.019G122100 0 1
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.002G098400 1.73 0.9840 AT2.2
AT1G73325 Kunitz family trypsin and prot... Potri.019G124500 2.00 0.9970
AT5G60700 glycosyltransferase family pro... Potri.009G010900 2.64 0.9595
AT1G73325 Kunitz family trypsin and prot... Potri.019G124400 5.47 0.9647
AT2G27690 CYP94C1 "cytochrome P450, family 94, s... Potri.009G145400 6.00 0.9532 CYP94C5,Pt-CYP94.4
AT1G73325 Kunitz family trypsin and prot... Potri.019G124432 6.32 0.9563
AT2G01150 RHA2B RING-H2 finger protein 2B (.1) Potri.005G081300 6.48 0.9368
AT1G11580 ATPMEPCRA methylesterase PCR A (.1) Potri.011G025400 9.64 0.9096
AT1G73325 Kunitz family trypsin and prot... Potri.019G124750 10.09 0.9304
AT1G30320 Remorin family protein (.1) Potri.001G358600 11.87 0.8966

Potri.019G122100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.