Potri.019G124100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05380 140 / 8e-42 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT2G38360 139 / 2e-41 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT3G56110 135 / 1e-39 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT2G40380 134 / 3e-39 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G01640 132 / 2e-38 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT5G07110 126 / 2e-36 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT1G04260 62 / 6e-12 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1)
AT1G08770 59 / 9e-11 PRA1.E prenylated RAB acceptor 1.E (.1)
AT1G55190 59 / 1e-10 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G17700 56 / 1e-09 PRA1.F1 prenylated RAB acceptor 1.F1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G074000 145 / 8e-44 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 145 / 8e-44 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.010G183300 144 / 5e-43 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.006G104400 142 / 1e-42 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.016G126400 140 / 2e-41 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.005G219100 97 / 3e-25 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G044000 91 / 9e-23 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G043800 79 / 5e-18 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 75 / 1e-16 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026404 172 / 2e-54 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1)
Lus10042246 172 / 8e-54 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10017425 148 / 1e-44 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10007533 146 / 4e-44 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10012224 145 / 2e-43 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 144 / 5e-43 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10002853 140 / 2e-41 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Lus10022680 120 / 2e-34 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1)
Lus10014234 81 / 3e-19 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1)
Lus10018774 81 / 8e-19 AT1G08770 130 / 5e-38 prenylated RAB acceptor 1.E (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Potri.019G124100.2 pacid=42774413 polypeptide=Potri.019G124100.2.p locus=Potri.019G124100 ID=Potri.019G124100.2.v4.1 annot-version=v4.1
ATGACCTCCCAAGCTCTCCCGATCTCTACCACCGAAACCACCTCCTCCACCACCACAACCCCAACCCTCACCACCCTCCGCACCTTCCTCACGCGCCTCT
TCTCTTCCCTCCGCACTACCCTCTCCCACCGCCGTCCCTGGCTCGAACTCGTCGACCGCACCGCCTTCTCCCGCCCCCTCTCCCTCTCCGACGCCACCAC
GCGAGTACGCAAAAACTTCTCCTACTTCAAAATAAATTACCTGACCATCCTCGCAATCGTACTCGCTTTCTCCCTCCTTTCACACCCATTCTCCCTCCTC
ACCCTCCTCTCCCTCGTCGCCGCCTGGCTCGGTCTCTACACCTTCCGGCCGTCAGATCAGCCCCTGGTAGTCCTCGGCCGTACGATGTCGAACAGGGAGG
TTTTGGGAATACTGGTTCTGGTGACGGTTATCGTTGTGTTCTTGACTAGCGTTGGGTCGTTGATTATAACGGCTGTTTTGGTTGGGGTAGGGATTGTGTG
TGTGCACGGAGCATTTAGGGATCCTGAGGATTTGTTCATGGATGATCAAGATACTGCTGGGTCCACTGGTTTGTTCTCTTTTATTGGTGGACCATCTGTG
GGATCCAATGTGATACCTCTAGTTTGA
AA sequence
>Potri.019G124100.2 pacid=42774413 polypeptide=Potri.019G124100.2.p locus=Potri.019G124100 ID=Potri.019G124100.2.v4.1 annot-version=v4.1
MTSQALPISTTETTSSTTTTPTLTTLRTFLTRLFSSLRTTLSHRRPWLELVDRTAFSRPLSLSDATTRVRKNFSYFKINYLTILAIVLAFSLLSHPFSLL
TLLSLVAAWLGLYTFRPSDQPLVVLGRTMSNREVLGILVLVTVIVVFLTSVGSLIITAVLVGVGIVCVHGAFRDPEDLFMDDQDTAGSTGLFSFIGGPSV
GSNVIPLV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G05380 PRA1.B3 prenylated RAB acceptor 1.B3 (... Potri.019G124100 0 1
AT2G41060 RNA-binding (RRM/RBD/RNP motif... Potri.005G081600 1.41 0.8564
AT5G22070 Core-2/I-branching beta-1,6-N-... Potri.001G215400 1.73 0.8198
AT3G16270 ENTH/VHS family protein (.1) Potri.001G187000 4.00 0.7589
AT1G11390 Protein kinase superfamily pro... Potri.004G032800 6.00 0.7398
AT5G14540 Protein of unknown function (D... Potri.001G348500 9.48 0.7558
AT5G23090 CCAAT NF-YB13 "nuclear factor Y, subunit B13... Potri.012G058200 14.49 0.7619 Pt-DR1.2
AT1G09810 ECT11 evolutionarily conserved C-ter... Potri.003G008400 17.66 0.6848
AT1G36370 SHM7 serine hydroxymethyltransferas... Potri.005G170800 17.66 0.7957
AT4G27000 ATRBP45C RNA-binding (RRM/RBD/RNP motif... Potri.001G423400 21.21 0.6868
AT3G02468 CPuORF9 conserved peptide upstream ope... Potri.004G106750 23.02 0.7681

Potri.019G124100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.