Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73325 56 / 1e-09 Kunitz family trypsin and protease inhibitor protein (.1) AT1G73330 45 / 1e-05 ATDR4 drought-repressed 4 (.1) AT1G17860 41 / 0.0002 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G124432 [exp] 376 / 7e-135 AT1G73325 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1) Potri.019G124750 [exp] 375 / 2e-134 AT1G73325 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1) Potri.019G124500 [exp] 270 / 5e-93 AT1G73325 61 / 4e-11 Kunitz family trypsin and protease inhibitor protein (.1) Potri.019G122100 [exp] 266 / 2e-91 AT1G73325 61 / 3e-11 Kunitz family trypsin and protease inhibitor protein (.1) Potri.010G007922 [exp] 215 / 3e-71 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1) Potri.010G007900 [exp] 215 / 3e-71 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1) Potri.010G007811 [exp] 215 / 3e-71 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1) Potri.010G007700 [exp] 205 / 2e-67 AT1G73325 62 / 1e-11 Kunitz family trypsin and protease inhibitor protein (.1) Potri.010G007822 [exp] 204 / 5e-67 AT1G17860 56 / 1e-09 Kunitz family trypsin and protease inhibitor protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039210 [exp] 69 / 2e-14 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1) Lus10026357 [exp] 69 / 2e-14 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013731 [exp] 68 / 1e-13 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1) Lus10042301 [exp] 66 / 2e-13 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013730 [exp] 66 / 3e-13 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1) Lus10022302 [exp] 67 / 6e-13 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1) Lus10011090 [exp] 63 / 5e-12 AT1G17860 161 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1) Lus10039209 [exp] 62 / 1e-11 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1) Lus10039208 [exp] 61 / 2e-11 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013732 [exp] 61 / 2e-11 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0066 [poplar] [flax] Trefoil PF00197 [poplar] [flax] Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence Show only first row Show all	>Potri.019G124400.2 pacid=42773861 polypeptide=Potri.019G124366.1.p locus=Potri.019G124400 ID=Potri.019G124400.2.v4.1 annot-version=v4.1 ATGAAGATGACTAACTTTCTAGTGCACTCCTTTCTTCTCTTTGCCTTCACGGCAACTTCAATATTTCCTCGTGCCGTTCATGCTGAAGCAGTGATCGATG TCTTCGGTGATGAGGTTAGAACTGGTGATCGTTATATCATCGGAGCCGCTTCGAATGACTTTGCGGTCACTTCCAGCCGTATCATATGCAATTCAGATGT TCTGTTTTCTCCAATGAGCGATGGACTCCCAGTAATATTTTCACCAGTTGTAGAATCCAACGACAGTGTCATCCACGAAGACAGTAATCTTAATGTGGAC TTTGATGCAGCCACATGTAGGATGGCGGGCGTATCAACCATGTGGAAGATTGAATTGAGGCCAACAGCGCGAGGATTCGTTGTGACCACAGGAGGTGTTG CTGGTTTGAATCGGTTTAAGATCACCAAGTATGAAGGTGGTAATAATTTGTATCAGCTTTCTTACTGTCCAATTTCCGAACCCATATGTGAATGCTCATG CGTCCCACTAGGCAAAGTTGTCAATCGCTTGGCTCCCAGTACCGTCCCTTTTCCTGTTGTGTTTGTACCATCCGATAGAGCTTCTAAAATCGAGTATAAA ATGATGTAA
AA sequence Show only first row Show all	>Potri.019G124400.2 pacid=42773861 polypeptide=Potri.019G124366.1.p locus=Potri.019G124400 ID=Potri.019G124400.2.v4.1 annot-version=v4.1 MKMTNFLVHSFLLFAFTATSIFPRAVHAEAVIDVFGDEVRTGDRYIIGAASNDFAVTSSRIICNSDVLFSPMSDGLPVIFSPVVESNDSVIHEDSNLNVD FDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAGLNRFKITKYEGGNNLYQLSYCPISEPICECSCVPLGKVVNRLAPSTVPFPVVFVPSDRASKIEYK MM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G73325			Kunitz family trypsin and prot...		Potri.019G124400 [exp]	0	1
AT1G73325			Kunitz family trypsin and prot...		Potri.019G124750 [exp]	1.41	0.9828
AT1G73325			Kunitz family trypsin and prot...		Potri.019G124432 [exp]	1.73	0.9816
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Potri.009G142300 [exp]	4.69	0.9294
AT1G73325			Kunitz family trypsin and prot...		Potri.019G122100 [exp]	5.47	0.9647
AT1G73325			Kunitz family trypsin and prot...		Potri.019G124500 [exp]	6.00	0.9601
					Potri.010G226050 [exp]	6.48	0.8728
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.002G098400 [exp]	11.22	0.9407	AT2.2
AT5G60700			glycosyltransferase family pro...		Potri.009G010900 [exp]	12.64	0.9304
					Potri.001G203500 [exp]	15.29	0.9327
AT2G27690		CYP94C1	"cytochrome P450, family 94, s...		Potri.009G145400 [exp]	16.73	0.9018	CYP94C5,Pt-CYP94.4

Compare expression of checked genes

Potri.019G124400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.