Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RIP1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36430 81 / 2e-18 Peroxidase superfamily protein (.1) AT5G05340 80 / 3e-18 Peroxidase superfamily protein (.1) AT5G66390 73 / 9e-16 Peroxidase superfamily protein (.1) AT2G18150 72 / 2e-15 Peroxidase superfamily protein (.1) AT1G14540 68 / 6e-14 Peroxidase superfamily protein (.1) AT1G44970 67 / 1e-13 Peroxidase superfamily protein (.1) AT4G33420 65 / 8e-13 Peroxidase superfamily protein (.1) AT2G18140 64 / 1e-12 Peroxidase superfamily protein (.1) AT1G14550 63 / 4e-12 Peroxidase superfamily protein (.1) AT5G58400 63 / 5e-12 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G156800 [exp] 136 / 9e-40 AT5G05340 345 / 7e-119 Peroxidase superfamily protein (.1) Potri.006G107000 [exp] 89 / 2e-21 AT5G05340 349 / 2e-120 Peroxidase superfamily protein (.1) Potri.014G143200 [exp] 86 / 2e-20 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.016G132900 [exp] 84 / 1e-19 AT5G05340 350 / 6e-121 Peroxidase superfamily protein (.1) Potri.013G083600 [exp] 77 / 3e-17 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1) Potri.013G154400 [exp] 77 / 3e-17 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1) Potri.013G156500 [exp] 76 / 6e-17 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1) Potri.010G236890 [exp] 76 / 1e-16 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1) Potri.010G236850 [exp] 74 / 5e-16 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009936 [exp] 105 / 1e-27 AT5G05340 361 / 5e-125 Peroxidase superfamily protein (.1) Lus10030145 [exp] 101 / 6e-26 AT5G05340 353 / 2e-121 Peroxidase superfamily protein (.1) Lus10009935 [exp] 100 / 1e-25 AT5G05340 358 / 9e-124 Peroxidase superfamily protein (.1) Lus10008581 [exp] 92 / 1e-22 AT5G05340 367 / 6e-128 Peroxidase superfamily protein (.1) Lus10009934 [exp] 85 / 4e-20 AT5G05340 372 / 5e-130 Peroxidase superfamily protein (.1) Lus10009933 [exp] 85 / 6e-20 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1) Lus10003573 [exp] 83 / 3e-19 AT5G05340 397 / 1e-139 Peroxidase superfamily protein (.1) Lus10030148 [exp] 82 / 3e-19 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1) Lus10034204 [exp] 82 / 8e-19 AT5G05340 336 / 9e-115 Peroxidase superfamily protein (.1) Lus10029065 [exp] 82 / 1e-18 AT5G05340 338 / 2e-115 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [poplar] [flax] Peroxidase PF00141 [poplar] [flax] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Potri.019G125500.2 pacid=42774166 polypeptide=Potri.019G125500.2.p locus=Potri.019G125500 ID=Potri.019G125500.2.v4.1 annot-version=v4.1 ATGACAGGATTTGAACCAGAGTCTAGCATGGAGGGAGTCAAATATGTCGTCTCTTCTGTAGAGACTGCGAGAGAGAGAAAGGAACATAAGAAAACTTATT TAGGAAGAAATGATTCAAGAACAGCAAGCAAAAATGACGTGAACAGCAATCCGCCCCTCCTAATTTTCAACTTCTCGCAGCTTCTTTCCATCTACCGATC TCATGGACTAGACTTCCAGGATGTAGTTGTCGTCTCAGCATCTCACTCAACTGGACTTGCTCGGTGCGTCACTCTCTGCGATCGAGATTTACAATGGCCC TGGTATAGAGTACTCCAATTTTGTTCCCTCCTTGAGGTCAAGAATTGCCCGCAAAGTGGTGGAGACCATGTTACGAAACCATTTGATTCAACTACAAGTT TCGATACAAAATATTTTATGGATTTGATGATGAAAAAGGCCCTCCTCCATTCTGCTCAGCAGCTATTCGGTCTTAATTTATTATCCGAGTTATAA
AA sequence Show only first row Show all	>Potri.019G125500.2 pacid=42774166 polypeptide=Potri.019G125500.2.p locus=Potri.019G125500 ID=Potri.019G125500.2.v4.1 annot-version=v4.1 MTGFEPESSMEGVKYVVSSVETARERKEHKKTYLGRNDSRTASKNDVNSNPPLLIFNFSQLLSIYRSHGLDFQDVVVVSASHSTGLARCVTLCDRDLQWP WYRVLQFCSLLEVKNCPQSGGDHVTKPFDSTTSFDTKYFMDLMMKKALLHSAQQLFGLNLLSEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G36430			Peroxidase superfamily protein...		Potri.019G125500 [exp]	0	1	RIP1.2
AT3G61680			alpha/beta-Hydrolases superfam...		Potri.014G097200 [exp]	1.41	0.8278
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Potri.008G024400 [exp]	24.91	0.7977
AT5G67470		ATFH6	ARABIDOPSIS FORMIN HOMOLOG 6, ...		Potri.007G054900 [exp]	29.29	0.6982
AT3G26840			Esterase/lipase/thioesterase f...		Potri.017G062200 [exp]	30.19	0.7358
AT5G60910	MADS	FUL, AGL8	FRUITFULL, AGAMOUS-like 8 (.1....		Potri.004G115400 [exp]	31.62	0.7908
					Potri.019G014314 [exp]	32.83	0.7746
AT2G33020		AtRLP24	receptor like protein 24 (.1)		Potri.011G141100 [exp]	32.83	0.7539
					Potri.001G447602 [exp]	33.58	0.7536
					Potri.009G114800 [exp]	47.24	0.7783
AT3G62200			Putative endonuclease or glyco...		Potri.013G003301 [exp]	48.64	0.7710

Compare expression of checked genes

Potri.019G125500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.