Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40470 226 / 7e-75 AS2 ASL11, LBD15 ASYMMETRIC LEAVES2-LIKE 11, LOB domain-containing protein 15 (.1) AT2G30340 189 / 5e-60 AS2 LBD13 LOB domain-containing protein 13 (.1) AT2G30130 131 / 5e-38 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) AT1G31320 126 / 2e-36 AS2 LBD4 LOB domain-containing protein 4 (.1) AT1G65620 125 / 7e-36 AS2 AS2 ASYMMETRIC LEAVES 2, Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT1G07900 123 / 5e-35 AS2 LBD1 LOB domain-containing protein 1 (.1) AT3G27650 121 / 1e-34 AS2 LBD25 LOB domain-containing protein 25 (.1) AT2G28500 122 / 4e-34 AS2 LBD11 LOB domain-containing protein 11 (.1) AT5G66870 123 / 7e-34 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) AT2G23660 121 / 6e-33 AS2 LBD10 LOB domain-containing protein 10 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G156200 [exp] 271 / 2e-92 AT2G40470 207 / 2e-67 ASYMMETRIC LEAVES2-LIKE 11, LOB domain-containing protein 15 (.1) Potri.013G081200 [exp] 250 / 2e-84 AT2G40470 249 / 2e-84 ASYMMETRIC LEAVES2-LIKE 11, LOB domain-containing protein 15 (.1) Potri.007G066700 [exp] 136 / 1e-40 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1) Potri.005G097800 [exp] 135 / 4e-40 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1) Potri.001G081400 [exp] 130 / 4e-38 AT1G31320 228 / 3e-77 LOB domain-containing protein 4 (.1) Potri.003G149000 [exp] 130 / 7e-38 AT1G31320 241 / 2e-82 LOB domain-containing protein 4 (.1) Potri.010G184400 [exp] 127 / 9e-37 AT2G30130 227 / 7e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.008G043900 [exp] 127 / 2e-36 AT1G07900 218 / 2e-72 LOB domain-containing protein 1 (.1) Potri.001G281600 [exp] 125 / 2e-36 AT2G30130 248 / 4e-85 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009930 [exp] 213 / 5e-70 AT2G30340 230 / 5e-76 LOB domain-containing protein 13 (.1) Lus10024183 [exp] 209 / 4e-68 AT2G30340 230 / 4e-76 LOB domain-containing protein 13 (.1) Lus10029061 [exp] 164 / 2e-50 AT2G30340 201 / 1e-64 LOB domain-containing protein 13 (.1) Lus10034208 [exp] 163 / 4e-50 AT2G30340 201 / 9e-65 LOB domain-containing protein 13 (.1) Lus10018275 [exp] 129 / 1e-37 AT1G31320 243 / 2e-83 LOB domain-containing protein 4 (.1) Lus10031285 [exp] 129 / 2e-37 AT2G30130 226 / 3e-76 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10040638 [exp] 128 / 5e-37 AT1G31320 244 / 1e-83 LOB domain-containing protein 4 (.1) Lus10031191 [exp] 127 / 5e-37 AT1G31320 199 / 2e-66 LOB domain-containing protein 4 (.1) Lus10031855 [exp] 125 / 3e-36 AT2G30130 220 / 4e-74 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10031769 [exp] 125 / 4e-36 AT1G31320 193 / 8e-64 LOB domain-containing protein 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [poplar] [flax] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Potri.019G127300.1 pacid=42774168 polypeptide=Potri.019G127300.1.p locus=Potri.019G127300 ID=Potri.019G127300.1.v4.1 annot-version=v4.1 ATGTCCAGAGACAGGGAGAGATTTGAAGAGATAGGAAAGAGGATCAAGAGGGAAAGCGATGCATCTTCTCTAATGGGAAGGAGACAAATGTTAGGTCCTC CTGGAATCTTGAATACTGTTACACCTTGTGCTGCATGTAAGCTTTTAAGGAGAAGATGTGCTGAAGAGTGCCCTTTTTCTCCATATTTTTCTCCACTTGA ACCCCAAAAATTTGCAGCTGTTCACAAAGTCTTTGGTGCAAGCAATGTCTCCAAGCTGCTAATGGAGGTGCCTGAAAGTCAAAGAGCTGATGCAGCAAAT AGTCTAGTTTATGAAGCAAACCTGAGGCTAAGAGATCCTGTCTATGGCTCTATGGGTGCAATTTCAGCCTTACAACAGCAAATTCAATTATTACAAGCTG AACTTAGTGCGACAAGGGCTGATATACTCAACTACAAATACAGAGAAGCTGCCGCTAGTAACATCATTTCTTCTACTCATGCTGCTTTAGTTTCTTCTGC AACCGCGTCCATTTCAGCACCATCACATACTCTTGCTCCACCACCTCCCCCTCCTCCCACCCCACCACCTCTTTCTGTTGTTGTTTCTTTATCTACATCT TCTCCTTCTCTATATACACCACCAACTAGCACATCAGGTTATAGCACTATTTCTAGTGATAATAATGTCCCATATTTTGATTAA
AA sequence Show only first row Show all	>Potri.019G127300.1 pacid=42774168 polypeptide=Potri.019G127300.1.p locus=Potri.019G127300 ID=Potri.019G127300.1.v4.1 annot-version=v4.1 MSRDRERFEEIGKRIKRESDASSLMGRRQMLGPPGILNTVTPCAACKLLRRRCAEECPFSPYFSPLEPQKFAAVHKVFGASNVSKLLMEVPESQRADAAN SLVYEANLRLRDPVYGSMGAISALQQQIQLLQAELSATRADILNYKYREAAASNIISSTHAALVSSATASISAPSHTLAPPPPPPPTPPPLSVVVSLSTS SPSLYTPPTSTSGYSTISSDNNVPYFD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G40470	AS2	ASL11, LBD15	ASYMMETRIC LEAVES2-LIKE 11, LO...		Potri.019G127300 [exp]	0	1
AT5G44440			FAD-binding Berberine family p...		Potri.011G162666 [exp]	1.73	0.9533
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.006G170800 [exp]	2.44	0.9500
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.006G171184 [exp]	3.87	0.9477
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Potri.016G104500 [exp]	5.00	0.9375
AT5G16770	MYB	ATMYB9	myb domain protein 9 (.1.2)		Potri.003G094200 [exp]	13.85	0.9184
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Potri.006G247700 [exp]	14.14	0.9356	Pt-WGA3.1
AT2G45430	AT-hook	AHL22	AT-hook motif nuclear-localize...		Potri.014G070800 [exp]	14.56	0.9418
AT2G38300	GARP		myb-like HTH transcriptional r...		Potri.009G075100 [exp]	14.89	0.9374
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Potri.010G061301 [exp]	15.68	0.8963
AT3G58000			VQ motif-containing protein (....		Potri.009G024200 [exp]	16.15	0.9353

Compare expression of checked genes

Potri.019G127300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.