Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05280 128 / 7e-38 RING/U-box superfamily protein (.1) AT3G10910 124 / 4e-36 RING/U-box superfamily protein (.1) AT5G01880 109 / 2e-30 RING/U-box superfamily protein (.1) AT1G49220 107 / 1e-28 RING/U-box superfamily protein (.1) AT1G49230 100 / 3e-26 RING/U-box superfamily protein (.1) AT1G49200 100 / 3e-26 RING/U-box superfamily protein (.1) AT1G49210 99 / 1e-25 RING/U-box superfamily protein (.1) AT1G20823 97 / 3e-25 RING/U-box superfamily protein (.1) AT1G76410 96 / 6e-25 ATL8 RING/U-box superfamily protein (.1) AT3G18773 95 / 3e-24 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G157000 [exp] 221 / 2e-74 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1) Potri.013G091300 [exp] 175 / 9e-56 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1) Potri.019G057700 [exp] 164 / 8e-52 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1) Potri.016G136200 [exp] 145 / 4e-44 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1) Potri.001G309600 [exp] 120 / 4e-34 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1) Potri.019G010500 [exp] 116 / 2e-32 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1) Potri.001G309700 [exp] 103 / 1e-27 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1) Potri.003G075200 [exp] 99 / 1e-26 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1) Potri.001G159300 [exp] 98 / 5e-26 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029037 [exp] 140 / 2e-42 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1) Lus10022743 [exp] 123 / 2e-35 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1) Lus10006788 [exp] 117 / 7e-33 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1) Lus10025146 [exp] 115 / 2e-32 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1) Lus10033515 [exp] 112 / 9e-31 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1) Lus10005814 [exp] 111 / 1e-30 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1) Lus10005817 [exp] 109 / 2e-29 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1) Lus10020859 [exp] 109 / 2e-29 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1) Lus10006787 [exp] 103 / 2e-27 AT1G49230 159 / 9e-49 RING/U-box superfamily protein (.1) Lus10006785 [exp] 102 / 4e-27 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.019G130100.1 pacid=42773403 polypeptide=Potri.019G130100.1.p locus=Potri.019G130100 ID=Potri.019G130100.1.v4.1 annot-version=v4.1 ATGCAAACTTCAGTAGTATACCGCCCGCACCGCTTGCTCTTGGGCATGGATTCTGGGATGCCACCTGATAGCCATGGATGCAGGAATTCGAGTATCCTCA ACAGTGATGAAAACAGCAACATGGTGATAGTTTTGGCAGCTTTGCTGTTTGCATTCTTATGTGCTCTTGGAATAAAGTCCATAGCACGTTGTGCTATAAG ATGTGGCTATAGAATTGGCTTTGAGACTCCGCAGCAAGCTGCTTCACGCCTAGCTGCGGCCACTAATACAGGACTAATGAAAAGTGCACTGGGGCAGATT CCGGTGGTAACTTATGAACCAGGACTAAATATTCAGGTCACTGATTGTACAATATGCCTTGGAGAGTTTTCGGAAGGCGAAAAGGTAAGAGTGCTACCAA AATGTAGCCATGGTTTCCATGTTAAATGCATAGACAAATGGTTATTGTTACATTCATCATGTCCCTTATGCCGACAAACATTAGCACTTGATCAGTCAGC AAATAATTGTGATGTAGATGAGCCGAATGTGAGAATCCCGGTCCTGGAAAATGGAACCGGCGGATAA
AA sequence Show only first row Show all	>Potri.019G130100.1 pacid=42773403 polypeptide=Potri.019G130100.1.p locus=Potri.019G130100 ID=Potri.019G130100.1.v4.1 annot-version=v4.1 MQTSVVYRPHRLLLGMDSGMPPDSHGCRNSSILNSDENSNMVIVLAALLFAFLCALGIKSIARCAIRCGYRIGFETPQQAASRLAAATNTGLMKSALGQI PVVTYEPGLNIQVTDCTICLGEFSEGEKVRVLPKCSHGFHVKCIDKWLLLHSSCPLCRQTLALDQSANNCDVDEPNVRIPVLENGTGG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05280			RING/U-box superfamily protein...		Potri.019G130100 [exp]	0	1
AT5G54770		THI4, TZ, THI1	THIAZOLE REQUIRING, THIAMINE4,...		Potri.011G025200 [exp]	1.00	0.9819
					Potri.017G079000 [exp]	1.41	0.9697
AT3G62550			Adenine nucleotide alpha hydro...		Potri.014G122000 [exp]	1.73	0.9695
AT4G32300		SD2-5	S-domain-2 5 (.1)		Potri.004G014301 [exp]	2.00	0.9681
AT1G70820			phosphoglucomutase, putative /...		Potri.008G131400 [exp]	2.23	0.9649
AT4G19170		CCD4, NCED4	carotenoid cleavage dioxygenas...		Potri.019G093400 [exp]	2.44	0.9649
AT1G06460		ACD31.2, ACD32....	ALPHA-CRYSTALLIN DOMAIN 31.2, ...		Potri.014G141500 [exp]	5.47	0.9627	Pt-ACD32.1
AT2G20540		MEF21	mitochondrial editing factor ...		Potri.001G471600 [exp]	5.56	0.9402
AT4G33490			Eukaryotic aspartyl protease f...		Potri.005G069600 [exp]	6.92	0.9551
AT3G20930			RNA-binding (RRM/RBD/RNP motif...		Potri.008G022280 [exp]	7.00	0.9645

Compare expression of checked genes

Potri.019G130100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.