Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78340 172 / 1e-55 ATGSTU22 glutathione S-transferase TAU 22 (.1) AT1G17170 157 / 7e-50 ATGSTU24 Arabidopsis thaliana Glutathione S-transferase \(class tau\) 24, glutathione S-transferase TAU 24 (.1) AT1G17180 156 / 3e-49 ATGSTU25 glutathione S-transferase TAU 25 (.1) AT1G78320 155 / 3e-49 ATGSTU23 glutathione S-transferase TAU 23 (.1) AT1G78370 155 / 5e-49 ATGSTU20 glutathione S-transferase TAU 20 (.1) AT1G78380 155 / 8e-49 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) AT1G17190 152 / 9e-48 ATGSTU26 glutathione S-transferase tau 26 (.1) AT1G78360 145 / 3e-45 ATGSTU21 glutathione S-transferase TAU 21 (.1) AT1G53680 135 / 3e-41 ATGSTU28 glutathione S-transferase TAU 28 (.1) AT3G43800 133 / 3e-40 ATGSTU27 glutathione S-transferase tau 27 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G130433 [exp] 211 / 6e-71 AT1G17180 292 / 3e-101 glutathione S-transferase TAU 25 (.1) Potri.001G437400 [exp] 170 / 6e-55 AT1G78380 316 / 2e-110 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.011G140800 [exp] 169 / 1e-54 AT1G78380 318 / 1e-111 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G436800 [exp] 167 / 1e-53 AT1G17180 308 / 2e-107 glutathione S-transferase TAU 25 (.1) Potri.001G436600 [exp] 166 / 2e-53 AT1G78380 318 / 2e-111 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G437200 [exp] 165 / 6e-53 AT1G78380 308 / 2e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.011G140700 [exp] 164 / 9e-53 AT1G78380 287 / 3e-99 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G437500 [exp] 163 / 1e-52 AT1G17180 232 / 2e-78 glutathione S-transferase TAU 25 (.1) Potri.005G037801 [exp] 161 / 2e-52 AT1G78340 197 / 7e-65 glutathione S-transferase TAU 22 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042469 [exp] 154 / 1e-48 AT1G78380 284 / 5e-98 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10042468 [exp] 154 / 1e-48 AT1G78380 306 / 6e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10026199 [exp] 160 / 3e-47 AT1G17160 496 / 8e-173 pfkB-like carbohydrate kinase family protein (.1.2) Lus10026198 [exp] 150 / 7e-47 AT1G78380 295 / 3e-102 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10042470 [exp] 145 / 4e-45 AT1G78380 291 / 1e-100 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10005592 [exp] 142 / 5e-44 AT1G17180 271 / 9e-93 glutathione S-transferase TAU 25 (.1) Lus10019480 [exp] 134 / 2e-40 AT1G17180 231 / 6e-77 glutathione S-transferase TAU 25 (.1) Lus10021102 [exp] 125 / 4e-37 AT3G09270 245 / 2e-82 glutathione S-transferase TAU 8 (.1) Lus10030020 [exp] 124 / 7e-37 AT1G17180 238 / 1e-79 glutathione S-transferase TAU 25 (.1) Lus10021103 [exp] 123 / 4e-36 AT3G09270 250 / 1e-84 glutathione S-transferase TAU 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF02798 [poplar] [flax] GST_N Glutathione S-transferase, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.019G130566.1 pacid=42773601 polypeptide=Potri.019G130566.1.p locus=Potri.019G130566 ID=Potri.019G130566.1.v4.1 annot-version=v4.1 ATGGAGGACAGAGTGACTCTATTGGATTTCTGGCCAAGTTCATGGGCAATGAGAGTGAAGGTTGCCTTGGCAGAGAAGGGGATAGAATACGAGTCCAGGG AACAGAACTTGATAGACAAGAGCTCTCTGCTTCTTGAAATGAACCCGGTTCATAAGATGATTCCTGTTCTTATTCACAATGGGAAGCCCATTTGTGAGTC ACATAATATTGTCCAATATATTGATGAGGTGTGGAAGGACAAGTCTCCATTGCTACCCTCGGATCCTTACCAAAGATCCCAAGCCAGATTCTGGGCTGAT TACATTGACAAGAAGGCGAGTATTTCAGTACTTGTTTAA
AA sequence Show only first row Show all	>Potri.019G130566.1 pacid=42773601 polypeptide=Potri.019G130566.1.p locus=Potri.019G130566 ID=Potri.019G130566.1.v4.1 annot-version=v4.1 MEDRVTLLDFWPSSWAMRVKVALAEKGIEYESREQNLIDKSSLLLEMNPVHKMIPVLIHNGKPICESHNIVQYIDEVWKDKSPLLPSDPYQRSQARFWAD YIDKKASISVLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G78340		ATGSTU22	glutathione S-transferase TAU ...		Potri.019G130566 [exp]	0	1
AT1G17180		ATGSTU25	glutathione S-transferase TAU ...		Potri.019G130433 [exp]	2.00	0.9871
AT4G39720			VQ motif-containing protein (....		Potri.001G158800 [exp]	3.87	0.8759
					Potri.006G260875 [exp]	4.47	0.8443
AT2G38905			Low temperature and salt respo...		Potri.010G217200 [exp]	5.19	0.8846
AT4G33467			unknown protein		Potri.007G109200 [exp]	6.92	0.8538
AT3G02645			Plant protein of unknown funct...		Potri.001G205100 [exp]	7.21	0.8817
AT4G39955			alpha/beta-Hydrolases superfam...		Potri.005G074066 [exp]	8.06	0.8393
AT1G11925			Stigma-specific Stig1 family p...		Potri.004G007100 [exp]	9.16	0.8608
AT5G58730			pfkB-like carbohydrate kinase ...		Potri.009G046200 [exp]	9.48	0.8523
AT2G46690			SAUR-like auxin-responsive pro...		Potri.002G176400 [exp]	9.79	0.8403

Compare expression of checked genes

Potri.019G130566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.