Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	UBC.10
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41700 304 / 3e-108 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT1G64230 304 / 4e-108 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G53300 301 / 7e-107 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT4G27960 300 / 2e-106 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT3G08690 296 / 4e-105 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G56150 285 / 7e-101 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT2G16740 279 / 2e-98 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT3G08700 251 / 2e-87 UBC12 ubiquitin-conjugating enzyme 12 (.1) AT3G13550 167 / 2e-53 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2) AT1G16890 154 / 6e-49 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G138900 [exp] 307 / 3e-109 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 306 / 3e-109 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.003G136200 [exp] 305 / 1e-108 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.001G094900 [exp] 302 / 2e-107 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.012G033000 [exp] 301 / 4e-107 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.015G023300 [exp] 301 / 4e-107 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.011G168200 [exp] 297 / 2e-105 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.001G471200 [exp] 296 / 6e-105 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.004G175000 [exp] 291 / 7e-103 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039323 [exp] 301 / 5e-107 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 301 / 5e-107 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 301 / 7e-107 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 301 / 7e-107 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10032352 [exp] 301 / 8e-107 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10021385 [exp] 300 / 2e-106 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014942 [exp] 300 / 2e-106 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 300 / 2e-106 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10033937 [exp] 298 / 6e-106 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10027846 [exp] 291 / 5e-103 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.019G131400.11 pacid=42774585 polypeptide=Potri.019G131400.11.p locus=Potri.019G131400 ID=Potri.019G131400.11.v4.1 annot-version=v4.1 ATGGCTTCCAAACGCATCTTGAAAGAGCTCAAGGACTTGCAGAAAGATCCACCTACGTCTTGCAGTGCTGGTCCAGTAGCTGAGGACATGTTCCATTGGC AAGCGACTATTATGGGACCTGCTGATAGCCCATATGCAGGAGGTGTCTTTTTAGTTTCTATTCATTTCCCTCCTGATTATCCTTTCAAGCCCCCCAAGGT TGCCTTCAGGACAAAAGTCTTCCACCCGAACATTAACAGCAATGGAAGCATATGTCTGGATATTCTTAAAGAGCAGTGGAGCCCTGCACTAACCATTTCC AAGGTGCTGCTATCTATATGCTCTCTGTTGACCGACCCAAATCCCGATGATCCACTTGTGCCTGAAATCGCTCACATGTACAAGACTGACAGGGCAAAGT ATGAGGCCACCGCCCGTAGCTGGACACAGAAGTATGCGATGGGTTGA
AA sequence Show only first row Show all	>Potri.019G131400.11 pacid=42774585 polypeptide=Potri.019G131400.11.p locus=Potri.019G131400 ID=Potri.019G131400.11.v4.1 annot-version=v4.1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTIS KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAMG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G41700		ATUBC8, UBC8	ARABIDOPSIS THALIANA UBIQUITIN...		Potri.019G131400 [exp]	0	1	UBC.10
AT5G11730			Core-2/I-branching beta-1,6-N-...		Potri.006G233400 [exp]	3.46	0.7026
AT1G36980			unknown protein		Potri.002G089300 [exp]	4.12	0.7357
AT1G60710		ATB2	NAD(P)-linked oxidoreductase s...		Potri.014G147700 [exp]	4.24	0.7317	Pt-ATB2.1
AT4G16695			unknown protein		Potri.003G078100 [exp]	5.29	0.6543
AT2G26800			Aldolase superfamily protein (...		Potri.009G068600 [exp]	9.74	0.6759
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Potri.012G117800 [exp]	10.19	0.6449	ARA7.1
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Potri.010G205800 [exp]	14.42	0.6184
AT1G25682			Family of unknown function (DU...		Potri.008G115700 [exp]	18.16	0.6334
AT1G62710		BETAVPE, BETA-V...	beta vacuolar processing enzym...		Potri.001G119800 [exp]	19.33	0.5889
AT5G06260			TLD-domain containing nucleola...		Potri.006G206200 [exp]	20.49	0.5791

Compare expression of checked genes

Potri.019G131400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.