Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05370 124 / 3e-39 Cytochrome b-c1 complex, subunit 8 protein (.1) AT3G10860 124 / 3e-39 Cytochrome b-c1 complex, subunit 8 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G159700 [exp] 143 / 5e-47 AT3G10860 120 / 8e-38 Cytochrome b-c1 complex, subunit 8 protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034442 [exp] 127 / 1e-40 AT3G10860 115 / 6e-36 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10019118 [exp] 97 / 2e-28 AT3G10860 96 / 2e-28 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10021674 [exp] 78 / 5e-21 AT5G05370 75 / 3e-20 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10035013 [exp] 77 / 8e-21 AT5G05370 75 / 6e-20 Cytochrome b-c1 complex, subunit 8 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0429 [poplar] [flax] UcrQ-like PF02939 [poplar] [flax] UcrQ UcrQ family
Representative CDS sequence Show only first row Show all	>Potri.019G132000.1 pacid=42773981 polypeptide=Potri.019G132000.1.p locus=Potri.019G132000 ID=Potri.019G132000.1.v4.1 annot-version=v4.1 ATGGGGAAGCAACCGGTGAAACTGAAGGCGGTGGTGTATGCTCTGTCACCGTTTCAGCAGAAGGTAATGCCTGGTCTCTGGAAAGATCTGCCCGGCAAGA TCCACCATAAAGTCTCCGAGAACTGGATCAGCGCCACCCTCCTCCTCGCTCCTCTCGTCGGCGTCTACACGTATGTGCAAAACTACCAGGAAAAGGAGAA GTTGGAACACAGGTACTGA
AA sequence Show only first row Show all	>Potri.019G132000.1 pacid=42773981 polypeptide=Potri.019G132000.1.p locus=Potri.019G132000 ID=Potri.019G132000.1.v4.1 annot-version=v4.1 MGKQPVKLKAVVYALSPFQQKVMPGLWKDLPGKIHHKVSENWISATLLLAPLVGVYTYVQNYQEKEKLEHRY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05370			Cytochrome b-c1 complex, subun...		Potri.019G132000 [exp]	0	1
AT3G48680		AtCAL2, GAMMACA...	gamma carbonic anhydrase-like ...		Potri.012G100400 [exp]	2.44	0.9376
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Potri.008G194900 [exp]	3.60	0.9102	Pt-POR1.1
AT5G49510		PFD3, PDF3	prefoldin 3 (.1.2)		Potri.010G147600 [exp]	3.87	0.9021
AT2G25310			Protein of unknown function (D...		Potri.006G257100 [exp]	4.89	0.9221
AT2G42210		ATOEP16-3	Mitochondrial import inner mem...		Potri.006G059300 [exp]	5.09	0.9307
AT1G04980		ATPDI10, ATPDIL...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.014G160000 [exp]	5.19	0.9172
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Potri.001G369000 [exp]	5.65	0.9190
AT5G15320			unknown protein		Potri.005G236500 [exp]	5.65	0.9009
AT2G40765			unknown protein		Potri.019G059500 [exp]	5.74	0.9147
AT1G64520		RPN12A	regulatory particle non-ATPase...		Potri.001G088200 [exp]	6.70	0.9216

Compare expression of checked genes

Potri.019G132000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.