Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58240 158 / 1e-50 FHIT FRAGILE HISTIDINE TRIAD (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G161100 [exp] 165 / 1e-53 AT5G58240 149 / 8e-47 FRAGILE HISTIDINE TRIAD (.1.2) Potri.002G248800 [exp] 41 / 5e-05 AT5G48545 227 / 3e-76 histidine triad nucleotide-binding 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019126 [exp] 164 / 6e-53 AT5G58240 236 / 6e-81 FRAGILE HISTIDINE TRIAD (.1.2) Lus10034436 [exp] 166 / 2e-52 AT5G58240 235 / 1e-78 FRAGILE HISTIDINE TRIAD (.1.2) Lus10038220 [exp] 39 / 0.0003 AT5G48545 216 / 7e-72 histidine triad nucleotide-binding 3 (.1) Lus10025883 [exp] 39 / 0.0003 AT5G48545 223 / 1e-74 histidine triad nucleotide-binding 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0265 [poplar] [flax] HIT PF01230 [poplar] [flax] HIT HIT domain
Representative CDS sequence Show only first row Show all	>Potri.019G133200.2 pacid=42773009 polypeptide=Potri.019G133200.2.p locus=Potri.019G133200 ID=Potri.019G133200.2.v4.1 annot-version=v4.1 ATGTGTGAACTGACTGAAGTGCATGCCATTAGTACCATGAAGCGCTTTGTTGATCTAACTGCTGATGAGACCAGTGATTTGTGGTTCACGGCAAAGAAGG TTGGCAGTCAGCTCGAGAGATTTCACAGTGCAACCTCACTCACATTTGCCATCCAAGATGGGCCGCAGGCAGGACAGACTGTGCCTCATGTTCATATTCA CATCATCCCAAGGAAAGGTGGTGACTTTGAGAAGAATGATGAGATATATGATGCAATTGATGAGAAGGAAAAGGAATTAAAGCAGAAGCTGGATTTAGAC AAGGAAAGGAGTGACAGAAGCATGGAGGAGATGGCTCAAGAGGCAGATGATTACAGATTGCTTTTCTTGTAG
AA sequence Show only first row Show all	>Potri.019G133200.2 pacid=42773009 polypeptide=Potri.019G133200.2.p locus=Potri.019G133200 ID=Potri.019G133200.2.v4.1 annot-version=v4.1 MCELTEVHAISTMKRFVDLTADETSDLWFTAKKVGSQLERFHSATSLTFAIQDGPQAGQTVPHVHIHIIPRKGGDFEKNDEIYDAIDEKEKELKQKLDLD KERSDRSMEEMAQEADDYRLLFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G58240		FHIT	FRAGILE HISTIDINE TRIAD (.1.2)		Potri.019G133200 [exp]	0	1
AT5G08520	MYB		Duplicated homeodomain-like su...		Potri.005G087700 [exp]	3.00	0.8673
AT5G06060			NAD(P)-binding Rossmann-fold s...		Potri.008G059100 [exp]	3.16	0.8687
AT5G26110			Protein kinase superfamily pro...		Potri.002G049900 [exp]	5.09	0.8730
AT3G51140			Protein of unknown function (D...		Potri.007G015600 [exp]	14.07	0.8211
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.013G076700 [exp]	14.31	0.8067	Pt-CYP89.3
AT1G53280		AtDJ1B	DJ-1 homolog B, Class I glutam...		Potri.011G111900 [exp]	15.81	0.8377
AT5G34930			arogenate dehydrogenase (.1)		Potri.008G074500 [exp]	19.13	0.7743
AT5G45040		CYTC6A	cytochrome c6A, Cytochrome c (...		Potri.015G121101 [exp]	22.64	0.8388
AT4G34412			unknown protein		Potri.004G141400 [exp]	29.86	0.8551
AT5G17460			unknown protein		Potri.004G091600 [exp]	32.24	0.8511

Compare expression of checked genes

Potri.019G133200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.