Potri.019G133550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.019G133550.1 pacid=42774600 polypeptide=Potri.019G133550.1.p locus=Potri.019G133550 ID=Potri.019G133550.1.v4.1 annot-version=v4.1
ATGGATATAATTAGACATAGATATAATAATGTACTCACATATTGTTTTTTGGGGTCTTGTAATGGCGATGGAAGTCAGGTAGTGAAGAAGAAGAAGAGGA
GACTAACAACTGGTACCCGCTCCGCCTCCGCCATTAGCAGCATAATTCTTTCTTCTATCCAGACTCTATCACTATGTAGTACCGGAAAAAGGGAAAACTT
TGGACGGAGCGGGGTCAACCAGATTACAAATATAGATGGAAGGAGAAAGACGATATTGGCTTTCTTCTCCGACTGCTTTCCTTGGGTGTGTGTGGATCGT
GGAACCAACTGGATGGGTATGGGCCTTGCGTAA
AA sequence
>Potri.019G133550.1 pacid=42774600 polypeptide=Potri.019G133550.1.p locus=Potri.019G133550 ID=Potri.019G133550.1.v4.1 annot-version=v4.1
MDIIRHRYNNVLTYCFLGSCNGDGSQVVKKKKRRLTTGTRSASAISSIILSSIQTLSLCSTGKRENFGRSGVNQITNIDGRRKTILAFFSDCFPWVCVDR
GTNWMGMGLA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.019G133550 0 1
AT3G15840 PIFI post-illumination chlorophyll ... Potri.001G204300 11.04 0.9408
AT1G51110 Plastid-lipid associated prote... Potri.001G011700 15.93 0.9345
Potri.011G080900 21.77 0.9274
AT1G07230 NPC1 non-specific phospholipase C1 ... Potri.001G250500 25.37 0.9264
AT5G23240 DNAJ heat shock N-terminal dom... Potri.001G347600 27.74 0.9240
AT5G58140 NPL1, PHOT2 NON PHOTOTROPIC HYPOCOTYL 1-LI... Potri.009G170640 36.94 0.9065
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Potri.010G073166 37.52 0.9117
Potri.010G010416 37.94 0.8901
AT1G64770 PnsB2, NDH45, N... Photosynthetic NDH subcomplex... Potri.019G034100 38.05 0.9203
AT3G46660 UGT76E12 UDP-glucosyl transferase 76E12... Potri.001G245900 39.50 0.9207

Potri.019G133550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.