Potri.019G133600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56380 183 / 3e-60 ARR17 response regulator 17 (.1)
AT2G40670 176 / 2e-57 ARR16 response regulator 16 (.1.2)
AT1G74890 170 / 2e-54 ARR15 response regulator 15 (.1)
AT2G41310 167 / 4e-53 ARR8, ATRR3 RESPONSE REGULATOR 8, response regulator 3 (.1)
AT1G10470 168 / 6e-53 IBC7, ATRR1, ARR4, MEE7 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1)
AT1G19050 166 / 7e-53 ARR7 response regulator 7 (.1)
AT1G59940 167 / 1e-52 ARR3 response regulator 3 (.1)
AT3G48100 165 / 1e-52 ATRR2, IBC6, ARR5 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1)
AT3G57040 164 / 2e-51 ATRR4, ARR9 RESPONSE REGULATOR 4, response regulator 9 (.1)
AT5G62920 162 / 2e-51 ARR6 response regulator 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G058900 196 / 3e-65 AT3G56380 223 / 5e-76 response regulator 17 (.1)
Potri.015G070000 170 / 4e-54 AT3G48100 231 / 1e-77 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1)
Potri.003G197466 167 / 2e-53 AT2G41310 232 / 5e-78 RESPONSE REGULATOR 8, response regulator 3 (.1)
Potri.T124806 166 / 5e-53 AT2G41310 232 / 6e-78 RESPONSE REGULATOR 8, response regulator 3 (.1)
Potri.001G027000 164 / 5e-52 AT2G41310 203 / 2e-66 RESPONSE REGULATOR 8, response regulator 3 (.1)
Potri.016G038000 161 / 1e-50 AT2G41310 242 / 2e-81 RESPONSE REGULATOR 8, response regulator 3 (.1)
Potri.010G037800 157 / 1e-48 AT1G59940 202 / 5e-65 response regulator 3 (.1)
Potri.006G041100 155 / 2e-48 AT3G57040 273 / 4e-93 RESPONSE REGULATOR 4, response regulator 9 (.1)
Potri.002G082200 152 / 7e-47 AT3G57040 180 / 1e-56 RESPONSE REGULATOR 4, response regulator 9 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004243 165 / 2e-52 AT3G48100 220 / 2e-73 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1)
Lus10042153 164 / 1e-51 AT3G48100 213 / 1e-70 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1)
Lus10039524 162 / 4e-51 AT3G57040 222 / 2e-73 RESPONSE REGULATOR 4, response regulator 9 (.1)
Lus10016334 156 / 1e-48 AT3G57040 211 / 5e-69 RESPONSE REGULATOR 4, response regulator 9 (.1)
Lus10002750 156 / 2e-48 AT3G57040 212 / 4e-69 RESPONSE REGULATOR 4, response regulator 9 (.1)
Lus10029211 151 / 3e-46 AT1G10470 211 / 4e-68 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1)
Lus10030664 143 / 8e-43 AT1G10470 206 / 2e-65 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1)
Lus10030822 142 / 2e-42 AT1G59940 201 / 2e-64 response regulator 3 (.1)
Lus10029027 115 / 8e-34 AT3G56380 121 / 4e-36 response regulator 17 (.1)
Lus10007885 117 / 2e-33 AT2G41310 143 / 1e-42 RESPONSE REGULATOR 8, response regulator 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0304 CheY PF00072 Response_reg Response regulator receiver domain
Representative CDS sequence
>Potri.019G133600.4 pacid=42774602 polypeptide=Potri.019G133600.4.p locus=Potri.019G133600 ID=Potri.019G133600.4.v4.1 annot-version=v4.1
ATGGCCAGCTCTTCTTCTTCCTTACCATCAATGGAGTTTGATTTTGATGAGAAACCACATGTGTTAGCTGTTGATGATAGTTTGATAGATCGCAAAGTCA
TTGAAAGGTTACTTATCAACTCTACATGCAGAGTGACCACAGCAGAAAACGGAAAGAGAGCATTGGAGTATTTGGGCTTAGCTGATGGACAACATCCCAG
CCATAGTGATTTGAAGGTGAATATGATCATCACCGATTATAGTATGCCAGGAATGACAGGTTATGAGCTGTTGAAAAGAATTAAGGAATCACCTACCATG
AAGGAGATACCGGTGGTTGTAGTGTCATCTGAGAACATCCCTACACGAATTAATCAGTGCATGGAGGGAGGAGCTCAAGAATTCTTGCTGAAGCCTCTTC
AGCTATCAGATGCGACAAAGCTGAGGTGCCATATAAAAAAGCTGAATAATTAA
AA sequence
>Potri.019G133600.4 pacid=42774602 polypeptide=Potri.019G133600.4.p locus=Potri.019G133600 ID=Potri.019G133600.4.v4.1 annot-version=v4.1
MASSSSSLPSMEFDFDEKPHVLAVDDSLIDRKVIERLLINSTCRVTTAENGKRALEYLGLADGQHPSHSDLKVNMIITDYSMPGMTGYELLKRIKESPTM
KEIPVVVVSSENIPTRINQCMEGGAQEFLLKPLQLSDATKLRCHIKKLNN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G56380 ARR17 response regulator 17 (.1) Potri.019G133600 0 1
Potri.006G183466 2.82 0.8371
AT3G26040 HXXXD-type acyl-transferase fa... Potri.007G139400 4.00 0.8371
AT1G03020 Thioredoxin superfamily protei... Potri.014G133800 4.69 0.6077
AT4G24340 Phosphorylase superfamily prot... Potri.013G100700 5.19 0.7837
Potri.010G039851 5.65 0.6563
AT4G24340 Phosphorylase superfamily prot... Potri.013G100800 6.70 0.7683
AT5G18600 Thioredoxin superfamily protei... Potri.010G021800 7.48 0.7314
AT1G30840 ATPUP4 purine permease 4 (.1.2) Potri.003G156900 8.36 0.7439
AT4G26490 Late embryogenesis abundant (L... Potri.001G468400 9.48 0.7056
AT3G62930 Thioredoxin superfamily protei... Potri.002G208700 11.95 0.6813 PtrGrx20

Potri.019G133600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.