Potri.T011201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G02130 76 / 6e-20 PDF2.3, LCR68 low-molecular-weight cysteine-rich 68 (.1)
AT2G02100 74 / 3e-19 LCR69, PDF2.2 low-molecular-weight cysteine-rich 69 (.1)
AT2G02120 73 / 5e-19 PDF2.1, LCR70 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1)
AT1G61070 71 / 5e-18 LCR66, PDF2.4 PLANT DEFENSIN 2.4, low-molecular-weight cysteine-rich 66 (.1)
AT5G63660 69 / 2e-17 LCR74, PDF2.5 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1)
AT2G31957 56 / 5e-12 LCR75, LCR79 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 79, low-molecular-weight cysteine-rich 75 (.1)
AT2G31953 52 / 2e-10 LCR76 low-molecular-weight cysteine-rich 76 (.1)
AT2G02140 52 / 2e-10 LCR72, PDF2.6 low-molecular-weight cysteine-rich 72 (.1)
AT2G02147 44 / 2e-07 LCR73 low-molecular-weight cysteine-rich 73 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.T011200 126 / 5e-40 AT2G02130 76 / 6e-20 low-molecular-weight cysteine-rich 68 (.1)
Potri.004G138100 104 / 2e-31 AT5G63660 71 / 4e-18 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1)
Potri.T011301 95 / 1e-27 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1)
Potri.T011300 95 / 1e-27 AT5G63660 62 / 2e-14 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 74, Scorpion toxin-like knottin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029544 81 / 6e-22 AT2G02130 87 / 4e-24 low-molecular-weight cysteine-rich 68 (.1)
Lus10004290 78 / 8e-21 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1)
Lus10004289 77 / 1e-20 AT2G02130 78 / 1e-20 low-molecular-weight cysteine-rich 68 (.1)
Lus10019226 77 / 3e-20 AT2G02120 81 / 6e-22 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1)
Lus10039622 61 / 4e-14 AT2G02120 65 / 5e-16 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1)
Lus10019227 62 / 5e-14 AT2G02130 66 / 1e-15 low-molecular-weight cysteine-rich 68 (.1)
Lus10000290 60 / 1e-13 AT2G02120 67 / 2e-16 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1)
Lus10029546 60 / 1e-13 AT2G02120 65 / 1e-15 LOW-MOLECULAR-WEIGHT CYSTEINE-RICH 70, Scorpion toxin-like knottin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0054 Knottin_1 PF00304 Gamma-thionin Gamma-thionin family
Representative CDS sequence
>Potri.T011201.1 pacid=42805713 polypeptide=Potri.T011201.1.p locus=Potri.T011201 ID=Potri.T011201.1.v4.1 annot-version=v4.1
ATGGAGAAGAAATGCTATGGTCTTTTCTTGTTGCTGCTCATTGCCCTGGCTTCCCAGGAAATGATGGTACCTGCTGAGGCTAGGGTTTGCTTGTCACAGA
GCCATAGTTTTAAAGGACCATGTGTAAGAGGCCACAACTGTGCTAGTGTGTGCAAGACTGAAGGTTTTCCCGGTGGTGAATGCAAAGGGTTCCGCCGCCG
CTGTTTTTGCGCCAAGCCTTGTTAG
AA sequence
>Potri.T011201.1 pacid=42805713 polypeptide=Potri.T011201.1.p locus=Potri.T011201 ID=Potri.T011201.1.v4.1 annot-version=v4.1
MEKKCYGLFLLLLIALASQEMMVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.T011201 0 1

Potri.T011201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.