Potri.T013500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G12220 54 / 9e-09 RPS5 RESISTANT TO P. SYRINGAE 5, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
AT4G27220 53 / 1e-08 NB-ARC domain-containing disease resistance protein (.1)
AT5G05400 52 / 5e-08 LRR and NB-ARC domains-containing disease resistance protein (.1)
AT1G61180 50 / 1e-07 LRR and NB-ARC domains-containing disease resistance protein (.1.2)
AT1G61300 49 / 2e-07 LRR and NB-ARC domains-containing disease resistance protein (.1)
AT1G12290 49 / 5e-07 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
AT1G63350 49 / 6e-07 Disease resistance protein (CC-NBS-LRR class) family (.1)
AT4G26090 47 / 1e-06 RPS2 RESISTANT TO P. SYRINGAE 2, NB-ARC domain-containing disease resistance protein (.1)
AT1G63360 47 / 2e-06 Disease resistance protein (CC-NBS-LRR class) family (.1)
AT1G61190 46 / 4e-06 LRR and NB-ARC domains-containing disease resistance protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.T045000 176 / 1e-51 AT4G27220 322 / 1e-94 NB-ARC domain-containing disease resistance protein (.1)
Potri.T045200 175 / 3e-51 AT4G27220 348 / 1e-104 NB-ARC domain-containing disease resistance protein (.1)
Potri.019G014360 168 / 5e-50 AT4G27220 173 / 3e-46 NB-ARC domain-containing disease resistance protein (.1)
Potri.019G014336 171 / 9e-50 AT4G27220 320 / 2e-92 NB-ARC domain-containing disease resistance protein (.1)
Potri.018G145530 166 / 7e-48 AT4G27220 278 / 8e-79 NB-ARC domain-containing disease resistance protein (.1)
Potri.T013300 166 / 7e-48 AT4G27220 278 / 8e-79 NB-ARC domain-containing disease resistance protein (.1)
Potri.019G014312 164 / 3e-47 AT4G27220 300 / 3e-86 NB-ARC domain-containing disease resistance protein (.1)
Potri.018G145578 163 / 5e-47 AT4G27220 311 / 3e-91 NB-ARC domain-containing disease resistance protein (.1)
Potri.018G136700 163 / 5e-47 AT4G27190 323 / 4e-94 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.T013500.2 pacid=42784463 polypeptide=Potri.T013500.2.p locus=Potri.T013500 ID=Potri.T013500.2.v4.1 annot-version=v4.1
ATGGTATATTTTCTGGTCTTAAGGAGTTCTTTTTTTTTTGGATGTACAAGTATGAAGAAGTTGTTCCCTCTTGTCTTCCTGCCAGACCTAGAAGTGATTG
AAGTTAGTAATTGTGAGAAAATGGAGGAGATAATAGAAATAAGATCAGATGATGAAGGGCTTATCGGTGAACTCGAACTTCCAAAGTTGAGAGATTTGAA
ATTGATTGAATTACCAGAATTGAAAAGTATTTTTAGTGAAAAACTGATTTGCCATTCTCTCAGAGTAATTCACGTAAGAAATTGTGCGAAGCTGAAGAGG
ATGCCAATTTGTCGTCCGTTGCTTGAAAATGGCCAGCTATCTCCTCCCCCTTCTCTCAGAGAAATCTATATAGAACCAGAAGAATGGTGGGAGACAGAAT
TGAAGTGGGAGCAATCTAACGCTAAGAATGTCCTTCGTCACTTAGTAAAGTTTAAAGAAGTACGGGCCGATGGTGAAGAAAGACCTCTTATTTAA
AA sequence
>Potri.T013500.2 pacid=42784463 polypeptide=Potri.T013500.2.p locus=Potri.T013500 ID=Potri.T013500.2.v4.1 annot-version=v4.1
MVYFLVLRSSFFFGCTSMKKLFPLVFLPDLEVIEVSNCEKMEEIIEIRSDDEGLIGELELPKLRDLKLIELPELKSIFSEKLICHSLRVIHVRNCAKLKR
MPICRPLLENGQLSPPPSLREIYIEPEEWWETELKWEQSNAKNVLRHLVKFKEVRADGEERPLI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.T013500 0 1

Potri.T013500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.