Potri.T034182 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15093 102 / 3e-28 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G135300 143 / 4e-44 AT4G15093 358 / 1e-125 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
Potri.018G145550 128 / 3e-40 AT4G15093 82 / 3e-20 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
Potri.004G135200 115 / 3e-33 AT4G15093 343 / 8e-120 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
Potri.018G136800 111 / 1e-31 AT4G15093 335 / 3e-116 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
Potri.T045400 110 / 2e-31 AT4G15093 338 / 1e-117 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034361 113 / 2e-32 AT4G15093 364 / 6e-128 catalytic LigB subunit of aromatic ring-opening dioxygenase family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0283 LigB PF02900 LigB Catalytic LigB subunit of aromatic ring-opening dioxygenase
Representative CDS sequence
>Potri.T034182.1 pacid=42784403 polypeptide=Potri.T034182.1.p locus=Potri.T034182 ID=Potri.T034182.1.v4.1 annot-version=v4.1
ATGGCTTTGATGGAAACATTTTATCTCTCACATGGAGCTCCAACACTTGCTATTGAAGAAACCGCACCAACAAGACAATTCTTTAAATCATGGCAACCAA
GTGTGTACAAAGAGAAACCGAGTTCCATTCTTGTTATTTCTGCTCACTGGGAGACCGAACCTACTGTTAATGTTGTTGATCGAAATGATACCATTCATGA
CTTCTATGGCTTCCCCAAGCCCTTGTACCAGGCTACACCTCTATGCTGA
AA sequence
>Potri.T034182.1 pacid=42784403 polypeptide=Potri.T034182.1.p locus=Potri.T034182 ID=Potri.T034182.1.v4.1 annot-version=v4.1
MALMETFYLSHGAPTLAIEETAPTRQFFKSWQPSVYKEKPSSILVISAHWETEPTVNVVDRNDTIHDFYGFPKPLYQATPLC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.T034182 0 1

Potri.T034182 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.