Potri.T045500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33420 441 / 7e-157 Peroxidase superfamily protein (.1)
AT5G42180 284 / 5e-95 PER64 peroxidase 64, Peroxidase superfamily protein (.1)
AT5G51890 275 / 2e-91 Peroxidase superfamily protein (.1)
AT1G05260 255 / 2e-83 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT4G11290 254 / 4e-83 Peroxidase superfamily protein (.1)
AT4G36430 251 / 8e-82 Peroxidase superfamily protein (.1)
AT3G03670 250 / 1e-81 Peroxidase superfamily protein (.1)
AT5G39580 246 / 3e-80 Peroxidase superfamily protein (.1.2)
AT5G17820 244 / 3e-79 Peroxidase superfamily protein (.1)
AT5G05340 243 / 7e-79 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G136900 617 / 0 AT4G33420 451 / 1e-160 Peroxidase superfamily protein (.1)
Potri.004G134800 553 / 0 AT4G33420 457 / 3e-163 Peroxidase superfamily protein (.1)
Potri.005G108900 286 / 1e-95 AT5G42180 442 / 2e-157 peroxidase 64, Peroxidase superfamily protein (.1)
Potri.002G018000 266 / 6e-88 AT5G42180 483 / 1e-173 peroxidase 64, Peroxidase superfamily protein (.1)
Potri.005G195600 265 / 3e-87 AT1G71695 460 / 4e-163 Peroxidase superfamily protein (.1)
Potri.002G065300 263 / 2e-86 AT1G71695 468 / 2e-166 Peroxidase superfamily protein (.1)
Potri.014G143200 256 / 4e-84 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.007G122451 255 / 1e-83 AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1)
Potri.015G003600 253 / 1e-82 AT1G05260 285 / 6e-95 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029543 464 / 8e-166 AT4G33420 479 / 1e-171 Peroxidase superfamily protein (.1)
Lus10017288 282 / 4e-94 AT5G42180 462 / 4e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10034547 281 / 1e-93 AT5G42180 471 / 7e-169 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10005614 281 / 1e-93 AT5G42180 461 / 6e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10031664 277 / 4e-92 AT5G51890 453 / 1e-161 Peroxidase superfamily protein (.1)
Lus10027405 276 / 7e-92 AT5G51890 448 / 2e-159 Peroxidase superfamily protein (.1)
Lus10010634 266 / 1e-87 AT1G44970 449 / 5e-159 Peroxidase superfamily protein (.1)
Lus10027164 254 / 5e-83 AT1G05260 463 / 3e-165 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10028736 253 / 6e-83 AT1G05260 266 / 4e-88 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10039680 253 / 7e-83 AT1G05260 458 / 3e-163 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.T045500.2 pacid=42784462 polypeptide=Potri.T045500.2.p locus=Potri.T045500 ID=Potri.T045500.2.v4.1 annot-version=v4.1
ATGGCTATGGCTAATTTTCTTGCTTTGTTTTTATTGATGGAGTTAATAGCAGGTGGTTATAGAGATGGAGCGAATGGCCTCAGCATGAACTACTACGTTT
TCAGCTGCCCATTTGCTGAGGCAATTGTGAGGAGCACAGTAACAAGTGCTTTGAAGTCTGATCCTACCTTAGCAGCTGGTCTTGTTAGAATGCATTTCCA
TGATTGCTGGATACAAGGATGTGATGGGTCTGTGCTGATAGACTCAACAAAGGATAACACAGCAGAGAAGGAATCTCCAGGAAATCAAAGCGTGAGAGGC
TTTGAACTCATTGATGATGTAAAGGAGCAACTTGAAGAGCAATGCCCTGGTGTTGTCTCATGCGCTGACATTGTTGCAATGGCTGCTAGAGAGGCTGTTG
CTTTGTCAGGAGGTCCAGTATATGACATACCAAAAGGAAGAAAAGATGGAAGGAGGTCTAAGATTGAAGATACTCTCAATGCGCCTGCTCCAACTTTTAA
TGCCTCGGAGCTCGTTAGAGTCTTTGGCCTCCGTGGTTTTAGTGCCCAAGACATGGTTGCCTTGTCTGGGGGGCACACACTAGGGGTGGCAAGGTGTTTA
ACGTTCAAAAATAGGTTGAGTGACCCTGTTGATCCGACTATGGATTCAGACTTTTCAAAGACTTTGTCCAAAACATGTAGTGGTGGAGACGATGCAGAAC
AAACATTTGATATGACAAGAAATAATTTTGATAACTTCTACTTCCAAGCATTGCAGAGGAAATCGGGAGTTCTTTTTTCAGACCAAACCCTATACAATAA
TCCAATAACAAAATCAATTGTCAAGGGCTACGCTATGAACCAGGCCAAGTTTTTCCTTGATTTTCAACAGGCAATGGTGAAAATGAGCTTGCTCGATGTC
AAGGAGGGATCACAAGGAGAAGTAAGAGCAGATTGTCGTAAAATTAACTGA
AA sequence
>Potri.T045500.2 pacid=42784462 polypeptide=Potri.T045500.2.p locus=Potri.T045500 ID=Potri.T045500.2.v4.1 annot-version=v4.1
MAMANFLALFLLMELIAGGYRDGANGLSMNYYVFSCPFAEAIVRSTVTSALKSDPTLAAGLVRMHFHDCWIQGCDGSVLIDSTKDNTAEKESPGNQSVRG
FELIDDVKEQLEEQCPGVVSCADIVAMAAREAVALSGGPVYDIPKGRKDGRRSKIEDTLNAPAPTFNASELVRVFGLRGFSAQDMVALSGGHTLGVARCL
TFKNRLSDPVDPTMDSDFSKTLSKTCSGGDDAEQTFDMTRNNFDNFYFQALQRKSGVLFSDQTLYNNPITKSIVKGYAMNQAKFFLDFQQAMVKMSLLDV
KEGSQGEVRADCRKIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.T045500 0 1

Potri.T045500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.