Potri.T045901 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G137700 332 / 7e-119 ND /
Potri.013G114000 55 / 1e-09 AT1G71910 48 / 7e-07 unknown protein
Potri.019G084500 55 / 1e-09 AT1G71910 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016934 56 / 6e-10 AT1G71910 54 / 3e-09 unknown protein
Lus10014823 54 / 8e-09 AT1G71980 488 / 3e-168 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
PFAM info
Representative CDS sequence
>Potri.T045901.1 pacid=42784446 polypeptide=Potri.T045901.1.p locus=Potri.T045901 ID=Potri.T045901.1.v4.1 annot-version=v4.1
ATGGTGTCAACAGAAGACTTCAGCTTCCCAAGGATCACCAACCCTCTTCCTCACTTTGCATTCTCTCCATCATTATGGCGTGTTTCTTCACTAGTTTATC
CGGATTATCGCTACGAAGACGACGAAAGAGAGTTGCCGTTTTTCAAGCAAAGTTTCTCCTTTACAACATGTCAGGAATTGAAGATAGAGAGTATTGAGGA
GAAGATGGATAGGTTGTGGGAGAAATTCAATGACGAGGAACTTCAAAGGGCTTCTTCTGATTCCTTGGGAGGAAAGAAAGGATCATATTCAGTTGATAGT
TTGGATTCTGAATGTGCTAGAGGAGAGTTGAAGCACCTTTGTCGTGTCAAGAAAGAGTTGAAGATTTCCAAATCAGACATGATAAGTGCTTCTACTCAGT
CTAAGAGACAACAGATTGTTATGGTGTTTAAGGTTTTGAAGAAGATGTTCTTGCATCCTATCTCATCAAAAGGTTTGAAGGTAGATAGAATATAG
AA sequence
>Potri.T045901.1 pacid=42784446 polypeptide=Potri.T045901.1.p locus=Potri.T045901 ID=Potri.T045901.1.v4.1 annot-version=v4.1
MVSTEDFSFPRITNPLPHFAFSPSLWRVSSLVYPDYRYEDDERELPFFKQSFSFTTCQELKIESIEEKMDRLWEKFNDEELQRASSDSLGGKKGSYSVDS
LDSECARGELKHLCRVKKELKISKSDMISASTQSKRQQIVMVFKVLKKMFLHPISSKGLKVDRI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.T045901 0 1

Potri.T045901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.