Potri.T124605 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G40390 42 / 0.0001 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G100901 254 / 1e-87 AT1G40390 43 / 6e-05 DNAse I-like superfamily protein (.1)
Potri.014G186236 203 / 8e-67 AT1G40390 86 / 2e-19 DNAse I-like superfamily protein (.1)
Potri.019G043150 179 / 9e-58 AT1G40390 58 / 3e-10 DNAse I-like superfamily protein (.1)
Potri.014G186733 178 / 6e-57 AT1G40390 70 / 1e-13 DNAse I-like superfamily protein (.1)
Potri.014G188601 169 / 2e-54 ND /
Potri.003G066101 141 / 3e-43 AT1G40390 62 / 1e-11 DNAse I-like superfamily protein (.1)
Potri.003G046951 108 / 3e-30 AT1G40390 48 / 9e-07 DNAse I-like superfamily protein (.1)
Potri.019G047420 109 / 4e-30 AT1G40390 65 / 2e-12 DNAse I-like superfamily protein (.1)
Potri.010G032101 106 / 2e-29 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016313 46 / 5e-06 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0530 DNase_I-like PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
Representative CDS sequence
>Potri.T124605.1 pacid=42808876 polypeptide=Potri.T124605.1.p locus=Potri.T124605 ID=Potri.T124605.1.v4.1 annot-version=v4.1
ATGATCATTTATAGCTGGAATATCAGGGGACTTAACAGTCCTCTGAAGCAGCATGAGGTTGCCAATCTCATGCGGAAGAATAAATTAGATGTTTGTGGCC
TTTTGGAGACTAAATTGGTTTCGTCTAAAGTGTCTTCGATGCAGCAATTCAGGTTGAAAAAATGGAAAGTCTTTTCCAATGCAGCAGTGGCCTCTACTGC
TAGAATTGTAGTCTTCTGGAATCCTGCAACTGTCAATGTTGATTTGATTGGTTTTTCGGCTCAAGGCCTTCATGTTCTTATTTATAGCTTGGTTCATCAG
TTCAGAGTCTATGCTTCTTTTGTTTATGGGTACAACACTGTTATCGCTAGGAGAACTCTTTGGGATGACTTGAGGAACTGGAGTCCTAATTCCCCCTGGC
TCATTCTCGGCGACTTCAACTCTCTTCTTTCCCAAGCTGATAAGCACTATGGGGAACCTGTATCCAACTATGAAACTACTGATTTCAGACAGTGCTGCTC
TGAACTTGGCTAA
AA sequence
>Potri.T124605.1 pacid=42808876 polypeptide=Potri.T124605.1.p locus=Potri.T124605 ID=Potri.T124605.1.v4.1 annot-version=v4.1
MIIYSWNIRGLNSPLKQHEVANLMRKNKLDVCGLLETKLVSSKVSSMQQFRLKKWKVFSNAAVASTARIVVFWNPATVNVDLIGFSAQGLHVLIYSLVHQ
FRVYASFVYGYNTVIARRTLWDDLRNWSPNSPWLILGDFNSLLSQADKHYGEPVSNYETTDFRQCCSELG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.T124605 0 1

Potri.T124605 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.