Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11150 64 / 4e-14 ATVAMP713 vesicle-associated membrane protein 713 (.1) AT4G32150 60 / 2e-12 ATVAMP711, VAMP7C vesicle-associated membrane protein 711 (.1) AT2G25340 55 / 2e-10 ATVAMP712 vesicle-associated membrane protein 712 (.1) AT5G22360 50 / 5e-09 ATVAMP714 vesicle-associated membrane protein 714 (.1) AT3G54300 38 / 0.0001 ATVAMP727 vesicle-associated membrane protein 727 (.1.2) AT1G04750 37 / 0.0005 ATVAMP7B, ATVAMP721, VAMP7B VESICLE-ASSOCIATED MEMBRANE PROTEIN 7B, vesicle-associated membrane protein 721 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G125900 [exp] 98 / 4e-27 AT4G32150 276 / 1e-94 vesicle-associated membrane protein 711 (.1) Potri.018G025800 [exp] 58 / 1e-11 AT4G32150 366 / 2e-130 vesicle-associated membrane protein 711 (.1) Potri.006G256200 [exp] 56 / 4e-11 AT4G32150 352 / 5e-125 vesicle-associated membrane protein 711 (.1) Potri.001G219200 [exp] 49 / 2e-08 AT5G22360 369 / 1e-131 vesicle-associated membrane protein 714 (.1) Potri.009G018900 [exp] 49 / 2e-08 AT5G22360 367 / 6e-131 vesicle-associated membrane protein 714 (.1) Potri.001G050400 [exp] 40 / 4e-05 AT2G33120 365 / 4e-130 ARABIDOPSIS THALIANA VESICLE-ASSOCIATED MEMBRANE PROTEIN 722, synaptobrevin-related protein 1 (.1.2.3) Potri.008G019400 [exp] 40 / 4e-05 AT3G54300 407 / 3e-146 vesicle-associated membrane protein 727 (.1.2) Potri.010G239900 [exp] 39 / 6e-05 AT3G54300 387 / 6e-138 vesicle-associated membrane protein 727 (.1.2) Potri.003G177700 [exp] 37 / 0.0006 AT1G04750 389 / 1e-139 VESICLE-ASSOCIATED MEMBRANE PROTEIN 7B, vesicle-associated membrane protein 721 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001492 [exp] 61 / 9e-13 AT5G11150 367 / 1e-130 vesicle-associated membrane protein 713 (.1) Lus10034189 [exp] 52 / 1e-09 AT5G22360 400 / 6e-144 vesicle-associated membrane protein 714 (.1) Lus10043394 [exp] 52 / 1e-09 AT5G22360 400 / 6e-144 vesicle-associated membrane protein 714 (.1) Lus10006192 [exp] 49 / 5e-08 AT5G11150 345 / 9e-121 vesicle-associated membrane protein 713 (.1) Lus10041035 [exp] 47 / 1e-07 AT5G11150 343 / 9e-122 vesicle-associated membrane protein 713 (.1) Lus10043431 [exp] 39 / 0.0001 AT3G54300 325 / 9e-111 vesicle-associated membrane protein 727 (.1.2) Lus10034145 [exp] 39 / 0.0001 AT3G54300 322 / 4e-109 vesicle-associated membrane protein 727 (.1.2) Lus10000192 [exp] 38 / 0.0001 AT2G44050 148 / 1e-45 coronatine insensitive1 suppressor, COI1 SUPPRESSOR1, 6,7-dimethyl-8-ribityllumazine synthase / DMRL synthase / lumazine synthase / riboflavin synthase (.1) Lus10011870 [exp] 37 / 0.0006 AT1G04760 376 / 3e-134 vesicle-associated membrane protein 726 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0445 [poplar] [flax] SNARE-fusion PF00957 [poplar] [flax] Synaptobrevin Synaptobrevin
Representative CDS sequence Show only first row Show all	>Potri.T125407.1 pacid=42776692 polypeptide=Potri.T125407.1.p locus=Potri.T125407 ID=Potri.T125407.1.v4.1 annot-version=v4.1 ATGATCGACAACATTGACAAAGTGTTGCAGAGGGGAGATCGGCTGGCGCTGCTAGTTGAAAAAACTTCCACATTGCAAGGAAATACAATTCGCTTTCGGC GACAGACTCAGCGTTTCAGAAATACACAGTGGTGGAGAAATTTCAAGCTCAAGGCTACATTGATACTATTTCTCTTGATTTTCATTTATACTGTACTCGC ATTGTTTTGTCACGGCCCTTCACTTCATTCCTGCTTGAAGTAG
AA sequence Show only first row Show all	>Potri.T125407.1 pacid=42776692 polypeptide=Potri.T125407.1.p locus=Potri.T125407 ID=Potri.T125407.1.v4.1 annot-version=v4.1 MIDNIDKVLQRGDRLALLVEKTSTLQGNTIRFRRQTQRFRNTQWWRNFKLKATLILFLLIFIYTVLALFCHGPSLHSCLK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.T125407 [exp]	0	1

Compare expression of checked genes

Potri.T125407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.