Lus10000582 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39780 154 / 3e-46 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G78080 145 / 5e-42 AP2_ERF CAF1, RAP2.4, WIND1 wound induced dedifferentiation 1, related to AP2 4 (.1)
AT1G22190 137 / 1e-39 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1)
AT2G22200 133 / 3e-38 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G65130 130 / 7e-37 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G36060 105 / 4e-27 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT4G13620 101 / 5e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G64380 91 / 2e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G20880 90 / 4e-21 AP2_ERF AtERF53 ERF domain 53, Integrase-type DNA-binding superfamily protein (.1)
AT4G28140 80 / 1e-17 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019665 332 / 1e-116 AT4G39780 209 / 1e-67 Integrase-type DNA-binding superfamily protein (.1)
Lus10016801 174 / 3e-53 AT1G78080 245 / 3e-79 wound induced dedifferentiation 1, related to AP2 4 (.1)
Lus10022497 167 / 1e-50 AT1G78080 248 / 2e-80 wound induced dedifferentiation 1, related to AP2 4 (.1)
Lus10033463 139 / 9e-40 AT1G78080 248 / 2e-80 wound induced dedifferentiation 1, related to AP2 4 (.1)
Lus10020913 134 / 8e-38 AT1G78080 246 / 2e-79 wound induced dedifferentiation 1, related to AP2 4 (.1)
Lus10003889 102 / 7e-26 AT1G64380 197 / 4e-61 Integrase-type DNA-binding superfamily protein (.1)
Lus10001898 101 / 2e-25 AT1G64380 210 / 1e-65 Integrase-type DNA-binding superfamily protein (.1)
Lus10016669 92 / 4e-22 AT4G13620 184 / 2e-55 Integrase-type DNA-binding superfamily protein (.1)
Lus10007124 91 / 7e-22 AT4G13620 181 / 1e-54 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G077300 160 / 2e-47 AT1G78080 207 / 7e-64 wound induced dedifferentiation 1, related to AP2 4 (.1)
Potri.002G094200 154 / 1e-45 AT1G78080 228 / 1e-72 wound induced dedifferentiation 1, related to AP2 4 (.1)
Potri.007G090600 153 / 1e-44 AT1G78080 205 / 4e-63 wound induced dedifferentiation 1, related to AP2 4 (.1)
Potri.005G168700 152 / 2e-44 AT1G78080 197 / 3e-60 wound induced dedifferentiation 1, related to AP2 4 (.1)
Potri.017G055400 103 / 1e-25 AT4G13620 216 / 9e-66 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G315300 100 / 2e-24 AT4G13620 194 / 3e-57 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G092400 96 / 3e-23 AT1G64380 181 / 1e-54 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G139300 90 / 3e-21 AT1G64380 173 / 1e-51 Integrase-type DNA-binding superfamily protein (.1)
Potri.013G135600 91 / 6e-21 AT2G20880 180 / 2e-52 ERF domain 53, Integrase-type DNA-binding superfamily protein (.1)
Potri.019G102200 88 / 3e-20 AT2G20880 195 / 2e-58 ERF domain 53, Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10000582 pacid=23154168 polypeptide=Lus10000582 locus=Lus10000582.g ID=Lus10000582.BGIv1.0 annot-version=v1.0
ATGGCTGCAGAGCTAATGGAGGCACTAGAACCTTTCATGAGATCCCCACCTTCTTCTTGTTTTTCCCTAAACCAGCTGAATCCATCTCAAATCCTCCAGA
TCCAAGCTCAGCTCCAAACCCAGATGACCAATTACAAAACCCCCCTGGCAGTTACTCCTTCCCCGATGAAGCGGTCCGCGGTTAAGCCGCCGACGAAGCT
TTACCGGGGAGTGAGGCAGCGCCACTGGGGGAAATGGGTAGCCGAAATCCGGCTACCCAAGAACCGAACCAGGCTCTGGCTCGGAACCTTCGAAACCGCC
GAGGAAGCCGCTCTCGCTTACGACCGAGCCGCTTACATGCTCCGAGGCGATTTCGCTCGGCTCAACTTCCCGCAGATGGTTCACACCGGCGGGCAGTTCA
TCAAAACCCTGCATTCTTCCGTCGAGGCTAAGCTCCAGGCTATATGCCAGAGCTTGGAGGAGAAGAAGAAAACAGGGGAGGTGGAAAACAGGGCATCCCC
TGTTAAAGTTGAGGAAGCAGAGGTTTCTTCTTCTTCTTCGAGTTCGAATTCGAATTCCGAGATTTCGTTCCTCGACTTCACCGAGACGGAATCGAGATGG
GGAATCGGAGAGACTTTCGGGTTGGAGAAGTTTCCTTCTGCAGAGATTGATTGGGCTGCTATCTGA
AA sequence
>Lus10000582 pacid=23154168 polypeptide=Lus10000582 locus=Lus10000582.g ID=Lus10000582.BGIv1.0 annot-version=v1.0
MAAELMEALEPFMRSPPSSCFSLNQLNPSQILQIQAQLQTQMTNYKTPLAVTPSPMKRSAVKPPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETA
EEAALAYDRAAYMLRGDFARLNFPQMVHTGGQFIKTLHSSVEAKLQAICQSLEEKKKTGEVENRASPVKVEEAEVSSSSSSSNSNSEISFLDFTETESRW
GIGETFGLEKFPSAEIDWAAI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39780 AP2_ERF Integrase-type DNA-binding sup... Lus10000582 0 1
AT4G39780 AP2_ERF Integrase-type DNA-binding sup... Lus10019665 3.5 0.9553
AT4G31830 unknown protein Lus10010682 10.2 0.9216
Lus10026056 11.3 0.9311
Lus10012304 15.2 0.9152
AT1G12110 CHL1-1, CHL1, B... CHLORINA 1, ARABIDOPSIS THALIA... Lus10024614 15.8 0.9261
AT4G35783 RTFL6, DVL17 DEVIL 17, ROTUNDIFOLIA like 6 ... Lus10041846 16.0 0.8871
AT4G09460 MYB ATMYB6, ATMYB8 myb domain protein 6 (.1) Lus10000411 23.0 0.9140
AT2G01980 ATSOS1, SOS1, A... ARABIDOPSIS SALT OVERLY SENSIT... Lus10039133 23.3 0.8996
AT4G33820 Glycosyl hydrolase superfamily... Lus10014646 23.4 0.8692
AT4G03965 RING/U-box superfamily protein... Lus10015152 23.5 0.9252

Lus10000582 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.