Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14370 89 / 4e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44670 88 / 8e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G44480 87 / 1e-19 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44630 86 / 4e-19 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT3G44400 83 / 3e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G04220 79 / 8e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G58120 79 / 1e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G56520 79 / 1e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT2G16870 78 / 2e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63880 77 / 3e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015453 [exp] 241 / 2e-77 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10014582 [exp] 222 / 2e-72 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10032101 [exp] 214 / 2e-67 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10000331 [exp] 149 / 5e-41 AT5G36930 217 / 1e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10001366 [exp] 148 / 8e-41 AT5G36930 424 / 1e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10038532 [exp] 145 / 5e-40 AT5G36930 307 / 3e-90 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10034697 [exp] 143 / 7e-39 AT5G36930 300 / 2e-85 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10001375 [exp] 142 / 1e-38 AT5G36930 464 / 3e-141 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10023272 [exp] 141 / 3e-38 AT5G36930 423 / 4e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T002300 [exp] 102 / 7e-25 AT5G36930 635 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 97 / 3e-23 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 97 / 4e-23 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 97 / 6e-23 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G052000 [exp] 94 / 6e-22 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143100 [exp] 92 / 6e-22 AT5G36930 234 / 1e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 94 / 7e-22 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 93 / 1e-21 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 93 / 1e-21 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 92 / 2e-21 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain CL0023 [flax] [poplar] P-loop_NTPase PF00931 [flax] [poplar] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Lus10001352 pacid=23162030 polypeptide=Lus10001352 locus=Lus10001352.g ID=Lus10001352.BGIv1.0 annot-version=v1.0 ATGACCTCTTCAAAGGTCGCACCATCGGCCCTGAGCTCATCATGGCCATTCATGAATCCAAGATCGGGATCCCCATCTTCTCCCCAAACTACGCCTCCAG CAAATGGCCTTCAAGAACTCGCCGAAATGGTTGACTGCAAGAGAAACAAAGGACAGATCATTCTTCCTGTCTTCTACTACGTTGACCCAACCGACGTCCG TCATCAGACCGAGACTTACAAACACGCGTTTCAACAGCACGATAAGAAGTTCAAGAAGGAGACTGTAGATCAATGGAGGTCTGCTTTGGCTGAGGTCGGA GCTTTGAAAGGATGGGTTGTCAAGGATTATAATGGGCAAGGAGCTACAATAGAGAAAGTTCTCCTAGATGTATGGTCAATTCTGAGGAGGGAGTACTTGT TAGTGACTGACGATTTGGTAGGCATTGAGCATCATGTAGAAGAAATGATGAAACGTCTGGATCCAGACTCCATTAATGAGACTGGTTTTCCCCCCGGGAG CAGGATCATTATCACAACGAGAGACAGAAAGGATCGTGAGATGTATGAACCGTCGGTAATGAGGGCAGAACATTCTCTTCAACTTTTCAGCAAGCATGCG TTTGGCATGGATTCTCCTCCAGAAGACTATGCAGAACTATCCGCGGATATTGTATCAGCTGTGGGAGGGGTTCCTTTTGCCCCTTAG
AA sequence Show only first row Show all	>Lus10001352 pacid=23162030 polypeptide=Lus10001352 locus=Lus10001352.g ID=Lus10001352.BGIv1.0 annot-version=v1.0 MTSSKVAPSALSSSWPFMNPRSGSPSSPQTTPPANGLQELAEMVDCKRNKGQIILPVFYYVDPTDVRHQTETYKHAFQQHDKKFKKETVDQWRSALAEVG ALKGWVVKDYNGQGATIEKVLLDVWSILRREYLLVTDDLVGIEHHVEEMMKRLDPDSINETGFPPGSRIIITTRDRKDREMYEPSVMRAEHSLQLFSKHA FGMDSPPEDYAELSADIVSAVGGVPFAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14370			Disease resistance protein (TI...		Lus10001352 [exp]	0	1
AT4G36850			PQ-loop repeat family protein ...		Lus10016795 [exp]	6.2	0.7287
AT1G11340			S-locus lectin protein kinase ...		Lus10030768 [exp]	19.2	0.7206
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Lus10031063 [exp]	23.6	0.7158
AT5G52900		MAKR6	MEMBRANE-ASSOCIATED KINASE REG...		Lus10027554 [exp]	25.1	0.7058
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Lus10001449 [exp]	25.1	0.7156
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10033663 [exp]	26.0	0.6607
AT3G47640	bHLH	PYE, bHLH047, P...	POPEYE, basic helix-loop-helix...		Lus10008622 [exp]	29.0	0.7146
AT3G11430		ATGPAT5, GPAT5	glycerol-3-phosphate acyltrans...		Lus10017794 [exp]	29.0	0.7086
AT3G01900		CYP94B2	"cytochrome P450, family 94, s...		Lus10041562 [exp]	30.6	0.6792
AT5G06440			unknown protein		Lus10013601 [exp]	36.7	0.6525

Compare expression of checked genes

Lus10001352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.