Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25390 156 / 2e-48 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 155 / 3e-48 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT1G15360 150 / 3e-46 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25190 86 / 6e-21 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT1G71450 77 / 8e-18 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G65130 75 / 4e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G20310 70 / 1e-14 AP2_ERF ATERF7, ATERF-7 ethylene response factor 7 (.1) AT1G22190 70 / 1e-14 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1) AT4G11140 70 / 2e-14 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT4G28140 69 / 3e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002912 [exp] 233 / 1e-78 AT5G25390 187 / 6e-61 shine3, Integrase-type DNA-binding superfamily protein (.1.2) Lus10005716 [exp] 166 / 7e-52 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 165 / 1e-51 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 149 / 1e-45 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 144 / 4e-43 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10043271 [exp] 102 / 5e-27 AT1G15360 160 / 2e-49 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10041023 [exp] 92 / 3e-23 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 82 / 4e-20 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10016815 [exp] 82 / 1e-19 AT5G25190 206 / 1e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G028000 [exp] 168 / 2e-53 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 169 / 3e-53 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 158 / 3e-49 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 149 / 3e-45 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 140 / 3e-42 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 87 / 9e-22 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 88 / 1e-21 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 87 / 1e-21 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.003G054100 [exp] 73 / 3e-16 AT1G71450 144 / 8e-44 Integrase-type DNA-binding superfamily protein (.1) Potri.019G075600 [exp] 71 / 2e-15 AT1G33760 147 / 6e-45 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10002015 pacid=23166975 polypeptide=Lus10002015 locus=Lus10002015.g ID=Lus10002015.BGIv1.0 annot-version=v1.0 ATGGTACAATCGAAGAAATACAGAGGTGTCAGGCAGCGTCAGTGGGGTTCTTGGGTCTCTGAGATTCGACACCCTTTACTGAAGAGGAGGGTGTGGCTGG GGACATTCGACACGGCGGAGGCGGCGGCGAGGGCGTACGACCGGGCCGCTGTCCACATGAGCGGCCGGAATGCGAAGACGAATTTCCCTGCCTCTACTTC TGATGATGATGATAATGCTTCACTGGGGGAGCTTCTGAATGCGAAGCTCCGCAAGTGCTGTGACACGTCGGGGTCTTCGATGACGTGTCTGAGGCTGGAC AGTAGTGACAGCTCTCACATTGGTGTTTGGCAGAAGTGCCCGGCTGGTGGGGCGCGGTCCTCCAGCTGGGTGATGCGGGTCCGCCTGGGAGGCGGTAGTA CTAGTGGTGGTTTTGACTCTGATCCTCCTCCTTCGGCACTTGTGCCGAAAGAGGAATCTTCTTCTTCTTTGTCGTCTTTGTCAGGTTCGGGGATGGTGGA AGAGAAGGAGGAAGATAGAATTGCCATGCAGATGATTGAAGAACTGCTTAAAATTGGGGTTGAAGAAGAATAG
AA sequence Show only first row Show all	>Lus10002015 pacid=23166975 polypeptide=Lus10002015 locus=Lus10002015.g ID=Lus10002015.BGIv1.0 annot-version=v1.0 MVQSKKYRGVRQRQWGSWVSEIRHPLLKRRVWLGTFDTAEAAARAYDRAAVHMSGRNAKTNFPASTSDDDDNASLGELLNAKLRKCCDTSGSSMTCLRLD SSDSSHIGVWQKCPAGGARSSSWVMRVRLGGGSTSGGFDSDPPPSALVPKEESSSSLSSLSGSGMVEEKEEDRIAMQMIEELLKIGVEEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10002015 [exp]	0	1
AT1G63710		CYP86A7	"cytochrome P450, family 86, s...		Lus10024644 [exp]	1.0	0.9685
AT2G20870			cell wall protein precursor, p...		Lus10039801 [exp]	2.4	0.9379
AT2G20870			cell wall protein precursor, p...		Lus10018569 [exp]	4.9	0.9194
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Lus10018350 [exp]	4.9	0.9149
AT3G55150		ATEXO70H1	exocyst subunit exo70 family p...		Lus10023455 [exp]	5.7	0.9045
AT4G27290			S-locus lectin protein kinase ...		Lus10039767 [exp]	5.7	0.8834
AT4G25640		FFT, ATDTX35	FLOWER FLAVONOID TRANSPORTER, ...		Lus10039263 [exp]	6.0	0.8940
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10035903 [exp]	8.1	0.8959
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10003107 [exp]	11.0	0.9120
AT5G20860			Plant invertase/pectin methyle...		Lus10033621 [exp]	11.2	0.9073

Compare expression of checked genes

Lus10002015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.