Lus10002451 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 132 / 3e-39 Cupredoxin superfamily protein (.1)
AT2G26720 95 / 3e-24 Cupredoxin superfamily protein (.1)
AT2G31050 87 / 2e-21 Cupredoxin superfamily protein (.1)
AT2G32300 84 / 1e-19 UCC1 uclacyanin 1 (.1)
AT4G31840 68 / 3e-14 AtENODL15 early nodulin-like protein 15 (.1)
AT3G17675 66 / 3e-14 Cupredoxin superfamily protein (.1)
AT3G27200 67 / 4e-14 Cupredoxin superfamily protein (.1)
AT2G25060 65 / 5e-13 AtENODL14 early nodulin-like protein 14 (.1)
AT3G20570 64 / 1e-12 AtENODL9 early nodulin-like protein 9 (.1)
AT5G07475 62 / 3e-12 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010533 246 / 6e-84 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10021925 189 / 2e-61 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10041211 184 / 3e-59 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10022350 72 / 7e-16 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10006657 74 / 2e-15 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10027143 72 / 3e-15 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10038098 72 / 9e-15 AT1G45063 107 / 1e-27 copper ion binding;electron carriers (.1.2)
Lus10041570 69 / 9e-15 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10019405 71 / 1e-14 AT1G45063 107 / 3e-27 copper ion binding;electron carriers (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G089900 157 / 5e-49 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.008G151000 156 / 2e-48 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.002G161300 111 / 3e-31 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.006G259000 110 / 8e-31 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.006G259101 109 / 2e-30 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.002G156100 106 / 3e-29 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G156401 106 / 3e-29 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.001G268700 105 / 6e-29 AT5G26330 138 / 6e-42 Cupredoxin superfamily protein (.1)
Potri.002G052500 93 / 8e-24 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.003G047300 92 / 6e-23 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10002451 pacid=23168990 polypeptide=Lus10002451 locus=Lus10002451.g ID=Lus10002451.BGIv1.0 annot-version=v1.0
ATGGCGGCCAGAGCAATTGGTTTGGCCACGGTGTTGTCAATGGCTGTTTTTCTGCAGCAAGTGATCCATGCCCATGGAGCAGCCGTACACAAGGTCGAGG
CCTCCGCCGGTTGGACCACCATTGGAAGTCCCGATTACAAGCAGTGGGCTGCAACTAAATCCTTCCAGGTTGGCGACATTGTCCATAAGTCACTTTTTTC
CTTTCCTTCTGTCTCGCACACCACCTCAACCACCCACATCATTTGGGAAGATACGTTCTTTTTCGTGATGAGAGTGACCCATGCCATGTACAGAGCATGC
AATGCCTCTTCTCCATTGGCAACATTCACAACAGGGAACGATTCAGTCAGCATAAGTACCCGCGGCCACCACTACTTCATCTGCGGAGTCAAAGGCCATT
GCCAGTCCGGTCAGAAGGTTGACATCAACGTCTTCCGCTCTTCATCTCCAGCTCCATCCTCCATGGCCGCCGCTCAAACTCCTGCACAATCCCCTGATCA
TTCTGCAAATTCAGCTTCTTCTACATTTACATTCATGGCTCTCACTCAAGCAGCTGCTATTTCCCTCGCCTTCACTATCCTCGCCTCCGCTTGA
AA sequence
>Lus10002451 pacid=23168990 polypeptide=Lus10002451 locus=Lus10002451.g ID=Lus10002451.BGIv1.0 annot-version=v1.0
MAARAIGLATVLSMAVFLQQVIHAHGAAVHKVEASAGWTTIGSPDYKQWAATKSFQVGDIVHKSLFSFPSVSHTTSTTHIIWEDTFFFVMRVTHAMYRAC
NASSPLATFTTGNDSVSISTRGHHYFICGVKGHCQSGQKVDINVFRSSSPAPSSMAAAQTPAQSPDHSANSASSTFTFMALTQAAAISLAFTILASA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26330 Cupredoxin superfamily protein... Lus10002451 0 1
AT2G21950 SKIP6 SKP1 interacting partner 6 (.1... Lus10030883 12.2 0.7166
AT1G08010 GATA GATA11 GATA transcription factor 11 (... Lus10037398 12.7 0.7777
AT5G46290 KAS1, KAS I, KA... KETOACYL-ACP SYNTHASE 1, 3-ket... Lus10004935 25.7 0.7679
AT3G57500 unknown protein Lus10012197 26.8 0.6646
AT3G61530 PANB2 Phosphoenolpyruvate carboxylas... Lus10010142 27.9 0.7660
AT5G06150 CYC1BAT, CYCB1;... cyclin B 1;2, Cyclin family pr... Lus10027330 29.7 0.7667
AT3G56130 biotin/lipoyl attachment domai... Lus10017424 37.1 0.7623
AT5G49170 unknown protein Lus10022872 39.6 0.7489
AT2G46410 MYB CPC CAPRICE, Homeodomain-like supe... Lus10007643 41.0 0.7119
AT2G40435 unknown protein Lus10025257 41.4 0.7232

Lus10002451 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.