Lus10002615 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 96 / 1e-25 Cupredoxin superfamily protein (.1)
AT3G17675 89 / 8e-24 Cupredoxin superfamily protein (.1)
AT2G31050 86 / 1e-21 Cupredoxin superfamily protein (.1)
AT2G02850 82 / 4e-21 ARPN plantacyanin (.1)
AT2G32300 85 / 8e-21 UCC1 uclacyanin 1 (.1)
AT2G26720 82 / 2e-20 Cupredoxin superfamily protein (.1)
AT5G07475 81 / 9e-20 Cupredoxin superfamily protein (.1)
AT3G27200 77 / 1e-18 Cupredoxin superfamily protein (.1)
AT5G15350 74 / 2e-17 AtENODL17 early nodulin-like protein 17 (.1)
AT1G72230 72 / 1e-16 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002614 134 / 2e-41 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
Lus10006680 105 / 1e-29 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1)
Lus10007027 103 / 8e-29 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1)
Lus10002617 106 / 1e-28 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1)
Lus10007025 101 / 4e-28 AT2G32300 101 / 3e-27 uclacyanin 1 (.1)
Lus10007028 101 / 5e-28 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10006682 99 / 7e-27 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Lus10041849 97 / 7e-27 AT2G02850 130 / 5e-40 plantacyanin (.1)
Lus10007026 98 / 8e-27 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G117900 105 / 6e-30 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.013G061300 105 / 7e-30 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.013G030450 100 / 9e-28 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030000 100 / 1e-27 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.006G259000 95 / 1e-25 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.003G047300 94 / 7e-25 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.010G089900 92 / 3e-24 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.006G259101 91 / 4e-24 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.008G151000 91 / 1e-23 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.002G161300 88 / 6e-23 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10002615 pacid=23168843 polypeptide=Lus10002615 locus=Lus10002615.g ID=Lus10002615.BGIv1.0 annot-version=v1.0
ATGGGTTATTATTCCAAATCCGTATCCCATAAGGATTTGCTGGCTTTGATGATCATCGTTGTAGCTTTTGCAGTCACGGATTCTGCCCACAACTCCTACA
CCGTCGGTGAGGCAAACGGTTGGACCGAGGAGGGCACCGATTATCAAACCTGGTCGACCAGCAAGGAATTCCACGCCGGGGACAAACTTGTTTTCCAGTA
TGGAGCGGGATCACACAACGTGTTGAAGGTCGGAAAGCTCGCATACGAGAAGTGCATCGTCCCTTCGGATCAGACGAAGGCGCTTACATCGGGAAACGAT
GTCGTTACATTGACTAAAGGTAAACACTACTACATTTGTGGCGTCTACGGTCACTGTGCCGGTGGTCAAAAGCTCGCCGTCGACGTCAAGGGATGA
AA sequence
>Lus10002615 pacid=23168843 polypeptide=Lus10002615 locus=Lus10002615.g ID=Lus10002615.BGIv1.0 annot-version=v1.0
MGYYSKSVSHKDLLALMIIVVAFAVTDSAHNSYTVGEANGWTEEGTDYQTWSTSKEFHAGDKLVFQYGAGSHNVLKVGKLAYEKCIVPSDQTKALTSGND
VVTLTKGKHYYICGVYGHCAGGQKLAVDVKG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26330 Cupredoxin superfamily protein... Lus10002615 0 1

Lus10002615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.