Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1) AT2G32300 81 / 1e-19 UCC1 uclacyanin 1 (.1) AT5G26330 78 / 6e-19 Cupredoxin superfamily protein (.1) AT2G26720 76 / 8e-18 Cupredoxin superfamily protein (.1) AT2G31050 74 / 2e-17 Cupredoxin superfamily protein (.1) AT3G17675 68 / 8e-16 Cupredoxin superfamily protein (.1) AT2G02850 64 / 6e-14 ARPN plantacyanin (.1) AT5G07475 62 / 7e-13 Cupredoxin superfamily protein (.1) AT4G12880 60 / 3e-12 AtENODL19 early nodulin-like protein 19 (.1.2) AT4G28365 60 / 5e-12 AtENODL3 early nodulin-like protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020275 [exp] 186 / 2e-61 AT3G27200 52 / 1e-08 Cupredoxin superfamily protein (.1) Lus10002617 [exp] 110 / 2e-30 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1) Lus10020276 [exp] 111 / 6e-30 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2) Lus10007026 [exp] 97 / 2e-26 AT2G32300 96 / 4e-25 uclacyanin 1 (.1) Lus10002614 [exp] 94 / 2e-25 AT2G32300 100 / 1e-26 uclacyanin 1 (.1) Lus10006683 [exp] 89 / 4e-23 AT5G26330 88 / 1e-22 Cupredoxin superfamily protein (.1) Lus10006680 [exp] 88 / 7e-23 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1) Lus10006682 [exp] 87 / 1e-22 AT2G32300 95 / 1e-24 uclacyanin 1 (.1) Lus10007028 [exp] 87 / 2e-22 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G061300 [exp] 95 / 8e-26 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1) Potri.003G117900 [exp] 95 / 1e-25 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1) Potri.013G030000 [exp] 88 / 6e-23 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.013G030450 [exp] 87 / 1e-22 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.013G054500 [exp] 83 / 3e-21 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1) Potri.001G332200 [exp] 82 / 2e-20 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 82 / 3e-20 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.019G037800 [exp] 81 / 3e-20 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 76 / 3e-18 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.003G183300 [exp] 76 / 4e-18 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10002618 pacid=23168848 polypeptide=Lus10002618 locus=Lus10002618.g ID=Lus10002618.BGIv1.0 annot-version=v1.0 ATGGTTATGGCAATTCTGGTCACTACTACTCCACCCACAGCTTTGGGTGAGACCTTTGTCGTTGGTGGTAACCAGGGCTGGAGAACCGGGGTCAACTTCG AGGCATGGGCTCGCGACAAGGTGTTTCGCGTCGGCGACAAACTTGTTTTCAAGTACCAGAAGTGCTTCCACAACGTGGTGAGGGTGATCCTCGAGGAGCA GTTCCAGAAGTGCACCGTCCCCGCGGGGGCCAAACAGCTAACATCAGGATACGACATTGTTCCCCTCACAACCGAGGGAAGGAAGTTCTTCGTGTGCGGC GTGGGAAGCAACTGCCTTGCTAGCTGCCAGAAGCTTGCTATATTTGTGAGGCCACACCATGGTTAA
AA sequence Show only first row Show all	>Lus10002618 pacid=23168848 polypeptide=Lus10002618 locus=Lus10002618.g ID=Lus10002618.BGIv1.0 annot-version=v1.0 MVMAILVTTTPPTALGETFVVGGNQGWRTGVNFEAWARDKVFRVGDKLVFKYQKCFHNVVRVILEEQFQKCTVPAGAKQLTSGYDIVPLTTEGRKFFVCG VGSNCLASCQKLAIFVRPHHG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27200			Cupredoxin superfamily protein...		Lus10002618 [exp]	0	1

Compare expression of checked genes

Lus10002618 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.