Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25390 148 / 1e-45 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 147 / 5e-45 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT1G15360 143 / 2e-43 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25190 81 / 2e-19 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT5G65130 75 / 2e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G71450 72 / 7e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G28140 69 / 6e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G11140 68 / 7e-14 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT1G28370 66 / 7e-14 AP2_ERF AtERF11 ERF domain protein 11 (.1) AT3G20310 67 / 1e-13 AP2_ERF ATERF7, ATERF-7 ethylene response factor 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002015 [exp] 227 / 3e-76 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 154 / 2e-47 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 154 / 2e-47 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 138 / 1e-41 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 139 / 2e-41 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10043271 [exp] 94 / 6e-24 AT1G15360 160 / 2e-49 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10041023 [exp] 86 / 3e-21 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 79 / 8e-19 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10035859 [exp] 77 / 8e-18 AT5G25190 196 / 9e-65 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G028000 [exp] 157 / 3e-49 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 155 / 4e-48 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 148 / 4e-45 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 143 / 9e-44 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 137 / 4e-41 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 83 / 5e-20 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 83 / 7e-20 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 81 / 3e-19 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.013G101100 [exp] 70 / 4e-15 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1) Potri.003G054100 [exp] 70 / 4e-15 AT1G71450 144 / 8e-44 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10002912 pacid=23148585 polypeptide=Lus10002912 locus=Lus10002912.g ID=Lus10002912.BGIv1.0 annot-version=v1.0 ATGGTACAATCAAAGAAATACAGAGGTGTCAGGCAGCGTCAGTGGGGTTCTTGGGTCTCCGAGATTCGCCACCCTTTACTGAAGAGGAGGGTGTGGCTGG GGACGTTCGACACGGCCGAGGCCGCGGCAAGGGCGTACGACCGGGCCGCCGTCCACATGAGCGGCCGCAATGCGAAGACGAATTTCCCTGCCTCTTCTTC CGATGATGATGATAATGCGTCACTTGGGGAACTTCTGAATGCGAAGCTCCGCAAGTGTTGTGACACATCGGCGTCTTCGATGACGTGTCTGAGGCTGGAC AGTAGTGACAGCTCTCACATTGGTGTCTGGCAGAAGCGCCCGGCTGGTGGGCCGCGGTCCTCCAGCTGGGTCATGCGGGTCCGCTTGGGAGGCGGTACTG GTGGTGGTTCTGATTCTGATCACCCCCCTCCGGCACCAGTGCTGGAGAGGGAGGAATCGTCTTCTTCTTTGTCGTCTTCGTCGGGTTCGGAGATGGTGGA AGAGAAAGAGGAAGATAGAATTGCTATGCAGATGATTGAAGAGCTGCTTGAAGAATAG
AA sequence Show only first row Show all	>Lus10002912 pacid=23148585 polypeptide=Lus10002912 locus=Lus10002912.g ID=Lus10002912.BGIv1.0 annot-version=v1.0 MVQSKKYRGVRQRQWGSWVSEIRHPLLKRRVWLGTFDTAEAAARAYDRAAVHMSGRNAKTNFPASSSDDDDNASLGELLNAKLRKCCDTSASSMTCLRLD SSDSSHIGVWQKRPAGGPRSSSWVMRVRLGGGTGGGSDSDHPPPAPVLEREESSSSLSSSSGSEMVEEKEEDRIAMQMIEELLEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25390	AP2_ERF	SHN3, SHN2	shine3, Integrase-type DNA-bin...		Lus10002912 [exp]	0	1
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10003107 [exp]	2.0	0.9577
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10004771 [exp]	3.5	0.9491
AT5G60020		LAC17, ATLAC17	laccase 17 (.1)		Lus10034614 [exp]	3.5	0.9335
AT5G11420			Protein of unknown function, D...		Lus10008080 [exp]	4.0	0.8881
AT3G05880		RCI2A	RARE-COLD-INDUCIBLE 2A, Low te...		Lus10019890 [exp]	5.7	0.8567
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10033741 [exp]	7.7	0.8693
AT2G21140		ATPRP2	proline-rich protein 2 (.1)		Lus10026281 [exp]	8.4	0.8998
AT1G63710		CYP86A7	"cytochrome P450, family 86, s...		Lus10024644 [exp]	9.2	0.9001
AT3G53810			Concanavalin A-like lectin pro...		Lus10029315 [exp]	10.0	0.8384
AT1G11340			S-locus lectin protein kinase ...		Lus10006745 [exp]	10.2	0.8329

Compare expression of checked genes

Lus10002912 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.