Lus10003212 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18193 130 / 2e-35 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17760 126 / 4e-35 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT5G17740 129 / 5e-35 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G50930 129 / 6e-35 BCS1 cytochrome BC1 synthesis (.1)
AT2G18190 126 / 3e-34 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17750 122 / 3e-33 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G17730 122 / 1e-32 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G50940 122 / 1e-32 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G25835 108 / 1e-27 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G28580 108 / 1e-27 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003213 176 / 3e-52 AT5G17740 430 / 7e-146 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10014284 125 / 1e-33 AT3G50930 535 / 0.0 cytochrome BC1 synthesis (.1)
Lus10025989 122 / 4e-33 AT3G50930 445 / 1e-153 cytochrome BC1 synthesis (.1)
Lus10041777 117 / 4e-33 AT5G17760 243 / 8e-79 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10015802 123 / 5e-33 AT3G50940 462 / 9e-161 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10024275 123 / 6e-33 AT3G50940 434 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10007391 123 / 7e-33 AT3G50940 424 / 2e-145 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10037004 120 / 5e-32 AT3G50930 457 / 9e-159 cytochrome BC1 synthesis (.1)
Lus10031318 117 / 1e-30 AT2G18193 415 / 1e-140 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G119900 142 / 4e-40 AT5G17760 512 / 3e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.007G020800 140 / 6e-39 AT5G17760 506 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.007G020600 130 / 1e-35 AT2G18193 553 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.007G020900 129 / 3e-35 AT3G50930 561 / 0.0 cytochrome BC1 synthesis (.1)
Potri.002G032700 129 / 4e-35 AT3G50930 437 / 1e-149 cytochrome BC1 synthesis (.1)
Potri.007G020500 127 / 8e-35 AT2G18193 511 / 1e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.009G119066 122 / 2e-32 AT3G50930 471 / 4e-161 cytochrome BC1 synthesis (.1)
Potri.009G119132 122 / 2e-32 AT3G50930 484 / 3e-166 cytochrome BC1 synthesis (.1)
Potri.008G177200 121 / 4e-32 AT3G50940 401 / 4e-136 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.010G057900 120 / 4e-32 AT3G50930 396 / 1e-133 cytochrome BC1 synthesis (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00004 AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence
>Lus10003212 pacid=23155761 polypeptide=Lus10003212 locus=Lus10003212.g ID=Lus10003212.BGIv1.0 annot-version=v1.0
ATGCTCAAGATTCACACCATTGACGGCAACGGAGGTTACGGACCTGGCGACAAATGGAAGTCCGTCAATTTGGATCACCCTTCGACCTTCGACACTCTGG
CTATGGAGCCGTCGCTGAAGAAGTCGATCGTCGAAGATCTGGATAGGTTTCGGGGGAGGAAAGAGTACTACAAGCGAGTCGGCCGGGCCTGGAAGCGTGG
CTATTTGCTTTACGGGCCACCGGGGACGGGGAAATCGATTCTGATTGCTGGCATGGCGAACTACTTGAAGTTCAACTCACCGCCATTCGTAGCGATTCGG
AGCTCCGAATGGCTAATAGGTCGATTCTCGTCATCTAGGATATCGATTGTAGCTGCGAATTTCCCGATCGGAATAACGACATCATGGTTGTGTGCCGAAA
TCGGAGAGTTCACCGACGAGGAGGATGCTAAGCTCATCCCCGCTAAAGCGACGGAGAAGCTCATGGAGAATAAAGATCCTGACGTGGCTTTGGATGGTCT
TTTGAATTTGCTGAAGAAGAAGAAGAAGAAGGAGGATGAGAAGAAGAAGAAGAAGAAGGGATTAGTTGTGGCAGCAAACAACGAAGAAGAAGAAGTATAC
TTCGACTTGGACTGA
AA sequence
>Lus10003212 pacid=23155761 polypeptide=Lus10003212 locus=Lus10003212.g ID=Lus10003212.BGIv1.0 annot-version=v1.0
MLKIHTIDGNGGYGPGDKWKSVNLDHPSTFDTLAMEPSLKKSIVEDLDRFRGRKEYYKRVGRAWKRGYLLYGPPGTGKSILIAGMANYLKFNSPPFVAIR
SSEWLIGRFSSSRISIVAANFPIGITTSWLCAEIGEFTDEEDAKLIPAKATEKLMENKDPDVALDGLLNLLKKKKKKEDEKKKKKKGLVVAANNEEEEVY
FDLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G50930 BCS1 cytochrome BC1 synthesis (.1) Lus10003212 0 1

Lus10003212 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.