Lus10003432 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25090 158 / 4e-49 AtENODL13 early nodulin-like protein 13 (.1)
AT2G25060 147 / 3e-45 AtENODL14 early nodulin-like protein 14 (.1)
AT5G57920 142 / 7e-43 AtENODL10 early nodulin-like protein 10 (.1)
AT4G31840 139 / 8e-42 AtENODL15 early nodulin-like protein 15 (.1)
AT4G30590 136 / 9e-41 AtENODL12 early nodulin-like protein 12 (.1)
AT2G23990 129 / 2e-37 AtENODL11 early nodulin-like protein 11 (.1.2)
AT3G20570 115 / 2e-32 AtENODL9 early nodulin-like protein 9 (.1)
AT5G53870 108 / 3e-28 AtENODL1 early nodulin-like protein 1 (.1)
AT3G18590 100 / 1e-26 AtENODL5 early nodulin-like protein 5 (.1)
AT1G48940 98 / 9e-26 AtENODL6 early nodulin-like protein 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026880 260 / 2e-89 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10019955 111 / 5e-31 AT4G30590 120 / 1e-34 early nodulin-like protein 12 (.1)
Lus10043063 110 / 5e-30 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Lus10011158 106 / 1e-28 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1)
Lus10036257 100 / 5e-27 AT2G25060 110 / 3e-31 early nodulin-like protein 14 (.1)
Lus10009617 93 / 1e-23 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1)
Lus10032111 91 / 6e-23 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
Lus10039852 90 / 2e-22 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1)
Lus10022318 90 / 2e-22 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G018200 184 / 2e-59 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.006G264600 182 / 1e-58 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.006G184100 163 / 3e-51 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.001G419200 108 / 3e-29 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1)
Potri.011G117800 104 / 7e-27 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.015G052000 100 / 8e-27 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1)
Potri.011G135400 100 / 1e-26 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.001G398800 100 / 3e-25 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
Potri.017G011200 94 / 5e-24 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.001G338800 91 / 5e-23 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10003432 pacid=23164887 polypeptide=Lus10003432 locus=Lus10003432.g ID=Lus10003432.BGIv1.0 annot-version=v1.0
ATGACGCTGCCGCCGCCGTTCCTTCTCCTCCTTACCCTCCTTTCTCTTCTCCTGCTTCTGTTTCGCCAGGAGCAGCGCTACTCCTCACAATTCGCCGCCG
CCAAAGAGCTACTAGTCGGCGGGAAGACCGATGCCTGGACTGTTCCATCTTCGGAATCCGATTCCCTCAACAGATGGGCCCAAAACACCCGCTTCCGCAT
CGGCGACTCTCTTGTGTGGAAGTACGACGGCACAAAGGACTCGGTGATGCAAGTGAGCAGGAAAGCATACCTGGGATGCAACACGACAGAGCCAATAGCA
GAGTACAAAGACGGGGAAACCAAAGTGAAGCTGGAAAGATCAGGTGCTTTCTACTTCATCAGTGGAGCTGAAGGACATTGCAAGCAAGGTCAGAAGGTCA
TCATCGTTGTCTTGTCTTCCAGGAAGAAGACGACTGTTGTTTTTTCACCTGCTCCAGCTCCTTCTCCTTCTGATGCTATGGCTCCTGCTGTTGCTCCCAC
CAGCGGTGGCGCTTCTTCAAGTTTCAATCTTGCTGCTGTTAGTGCTCTGTTTTCGGGGTTGGGTCTTGTGGGTTTGCTGTTCTGA
AA sequence
>Lus10003432 pacid=23164887 polypeptide=Lus10003432 locus=Lus10003432.g ID=Lus10003432.BGIv1.0 annot-version=v1.0
MTLPPPFLLLLTLLSLLLLLFRQEQRYSSQFAAAKELLVGGKTDAWTVPSSESDSLNRWAQNTRFRIGDSLVWKYDGTKDSVMQVSRKAYLGCNTTEPIA
EYKDGETKVKLERSGAFYFISGAEGHCKQGQKVIIVVLSSRKKTTVVFSPAPAPSPSDAMAPAVAPTSGGASSSFNLAAVSALFSGLGLVGLLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25090 AtENODL13 early nodulin-like protein 13 ... Lus10003432 0 1
AT4G26590 ATOPT5 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10043161 4.2 0.8584
AT3G15010 RNA-binding (RRM/RBD/RNP motif... Lus10021035 5.0 0.8777
Lus10016909 6.7 0.8254
AT1G67950 RNA-binding (RRM/RBD/RNP motif... Lus10034580 8.9 0.8300
AT5G06800 GARP myb-like HTH transcriptional r... Lus10023816 15.1 0.8337
Lus10001746 22.7 0.7011
AT5G24860 ATFPF1, FPF1 ARABIDOPSIS FLOWERING PROMOTIN... Lus10000506 24.3 0.7875
Lus10017380 29.0 0.7151
AT5G41850 alpha/beta-Hydrolases superfam... Lus10032373 31.7 0.7979
AT1G27990 unknown protein Lus10015763 34.9 0.7857

Lus10003432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.