Lus10003513 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33760 104 / 3e-28 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G71450 86 / 6e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G11590 76 / 5e-17 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1)
AT2G44940 76 / 9e-17 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT3G16280 73 / 1e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G77200 72 / 2e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G25820 71 / 4e-15 AP2_ERF ESE2 ethylene and salt inducible 2, Integrase-type DNA-binding superfamily protein (.1)
AT3G60490 71 / 6e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G35700 69 / 8e-15 AP2_ERF ATERF38 ERF family protein 38 (.1)
AT4G32800 70 / 1e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002953 265 / 2e-91 AT1G33760 143 / 2e-43 Integrase-type DNA-binding superfamily protein (.1)
Lus10041052 145 / 5e-44 AT1G33760 143 / 3e-43 Integrase-type DNA-binding superfamily protein (.1)
Lus10006173 86 / 4e-21 AT1G71450 167 / 4e-53 Integrase-type DNA-binding superfamily protein (.1)
Lus10041050 84 / 2e-20 AT1G71450 189 / 1e-61 Integrase-type DNA-binding superfamily protein (.1)
Lus10006172 77 / 3e-18 AT1G33760 79 / 6e-19 Integrase-type DNA-binding superfamily protein (.1)
Lus10034949 74 / 9e-16 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1)
Lus10002801 71 / 4e-15 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10004738 71 / 4e-15 AT2G35700 144 / 7e-44 ERF family protein 38 (.1)
Lus10007799 69 / 4e-15 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G101200 117 / 2e-33 AT1G33760 149 / 1e-45 Integrase-type DNA-binding superfamily protein (.1)
Potri.019G075600 111 / 5e-31 AT1G33760 147 / 6e-45 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G054100 107 / 3e-29 AT1G71450 144 / 8e-44 Integrase-type DNA-binding superfamily protein (.1)
Potri.013G101100 99 / 5e-26 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G181500 95 / 1e-24 AT1G71450 184 / 8e-60 Integrase-type DNA-binding superfamily protein (.1)
Potri.019G075500 94 / 3e-24 AT1G71450 200 / 5e-66 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G079300 71 / 3e-15 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G155700 70 / 1e-14 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G085700 70 / 2e-14 AT4G32800 155 / 4e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G238600 70 / 2e-14 AT5G11590 199 / 8e-64 TINY2, Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10003513 pacid=23157277 polypeptide=Lus10003513 locus=Lus10003513.g ID=Lus10003513.BGIv1.0 annot-version=v1.0
ATGGAGGAATGCGGCGGGGAAGGGCGGCGGAGGTACAGAGGTGTGAGGCAGAGGAGGTGGGGGAAGTGGGTGTCCGAAATCCGGGAGCCGGGGAAGAAGA
CAAGGATATGGCTAGGGAGCTACGAGACGGCGGAGATGGCTGCAGCGGCCTACGACGCTGCCGCATTGTTCCTACGTGGAAGGGAGGGGCTCAACTTTCC
GGAGTTAGCCGATGGTCTCCCCCGTCCGGCCAGCTCCAGCGCGGAGGACGTCCAGACGGCGGCGCAACTGGCGGCGGCCCGGATGGTTAATGGCGGGTCA
AATAACTTAGGTGGTGGGTTGAGGCCGGTAAGGGTTGGGTTGACTCCCGGTCAAATTCAGGCGATTAATGAGACGCCGATGGATTCTCCGAATTACATGT
ATTGGATGGAGCTTGCTGCCGGAGCTCTGCTGTCGCCGGGAAAGCAAGAGTACAACGGTGCCGTTTCGATGGATTTGGGTGATGTTATTGACGGCTGTGA
TTTCAGTGGTTTGGAGGAAATCATGGAAATGCATCATTACCAGCCGTCCATTTGGGATTACTACTCATAA
AA sequence
>Lus10003513 pacid=23157277 polypeptide=Lus10003513 locus=Lus10003513.g ID=Lus10003513.BGIv1.0 annot-version=v1.0
MEECGGEGRRRYRGVRQRRWGKWVSEIREPGKKTRIWLGSYETAEMAAAAYDAAALFLRGREGLNFPELADGLPRPASSSAEDVQTAAQLAAARMVNGGS
NNLGGGLRPVRVGLTPGQIQAINETPMDSPNYMYWMELAAGALLSPGKQEYNGAVSMDLGDVIDGCDFSGLEEIMEMHHYQPSIWDYYS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G33760 AP2_ERF Integrase-type DNA-binding sup... Lus10003513 0 1
AT1G33760 AP2_ERF Integrase-type DNA-binding sup... Lus10002953 1.0 0.9665
AT5G28840 GME "GDP-D-mannose 3',5'-epimerase... Lus10020247 1.4 0.9316
Lus10028607 3.5 0.9127
AT1G79910 Regulator of Vps4 activity in ... Lus10035885 4.0 0.8839
AT3G26300 CYP71B34 "cytochrome P450, family 71, s... Lus10035706 7.7 0.7997
AT2G24400 SAUR-like auxin-responsive pro... Lus10033348 9.2 0.8565
AT2G22795 unknown protein Lus10028240 9.5 0.8374
AT5G25840 Protein of unknown function (D... Lus10006044 11.2 0.8473
AT4G23900 Nucleoside diphosphate kinase ... Lus10023076 13.0 0.7775
AT5G25840 Protein of unknown function (D... Lus10000571 15.0 0.8447

Lus10003513 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.