Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21910 102 / 8e-27 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT1G44830 100 / 2e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G77640 86 / 2e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G16750 74 / 1e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G50260 72 / 3e-16 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT4G36900 73 / 5e-16 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT1G19210 72 / 6e-16 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G77200 72 / 1e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G35700 71 / 2e-15 AP2_ERF ATERF38 ERF family protein 38 (.1) AT2G23340 70 / 3e-15 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028032 [exp] 148 / 5e-46 AT1G21910 117 / 1e-33 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Lus10011123 [exp] 72 / 5e-16 AT5G11590 143 / 6e-43 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10009468 [exp] 71 / 5e-16 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 72 / 2e-15 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10007799 [exp] 70 / 2e-15 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1) Lus10001601 [exp] 71 / 3e-15 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10033420 [exp] 71 / 5e-15 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10010043 [exp] 69 / 5e-15 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10004738 [exp] 70 / 7e-15 AT2G35700 144 / 7e-44 ERF family protein 38 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G085600 [exp] 102 / 3e-27 AT1G77640 127 / 3e-36 Integrase-type DNA-binding superfamily protein (.1) Potri.005G176000 [exp] 101 / 1e-26 AT1G21910 140 / 3e-41 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Potri.006G138900 [exp] 74 / 7e-17 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 72 / 3e-16 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.003G079300 [exp] 73 / 6e-16 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1) Potri.013G100300 [exp] 72 / 8e-16 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1) Potri.006G218200 [exp] 72 / 8e-16 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.006G238600 [exp] 71 / 5e-15 AT5G11590 199 / 8e-64 TINY2, Integrase-type DNA-binding superfamily protein (.1) Potri.001G155700 [exp] 71 / 6e-15 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1) Potri.007G046500 [exp] 70 / 6e-15 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10003740 pacid=23169654 polypeptide=Lus10003740 locus=Lus10003740.g ID=Lus10003740.BGIv1.0 annot-version=v1.0 ATGGTGAAGACTGATGATCATCAAGCTCCGGACAACAACAACAACAACAACAACATGATCAAGAGTACTACTAAGAAGAAGTCATCGTCAATGATGGTGA AGAAGTTCAAAGGAGTGAGAATGAGAAGCTGGGGCTCATGGGTTTCCGAGATCCGCGCTCCCAACCAAAAAACCAGAATCTGGCTCGGTTCTTACTCCAC CCCTGAAGCCGCAGCCCGAGCCTACGACGCCGCCCTCCTCTGCCTCAAAGGCTCCTCCGCCGCCGCCCCCACTCTCAACTTCCCCACCTCTTCCTACGCC CATTACCACACCTACACCTCCGCCGCCCCCGTTGCCGCCCCCATGTCCCCCAAGTCCATCCAACGTATCGCCGCCGCCGCAGCCGCCAATGCCCCCACAA CCGACATCATCCATCAACAACCACCGCAGCCTCAGCCGTCATTATCATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCCGCCGCCGCCGATGTTCGACGACTTTTATGA
AA sequence Show only first row Show all	>Lus10003740 pacid=23169654 polypeptide=Lus10003740 locus=Lus10003740.g ID=Lus10003740.BGIv1.0 annot-version=v1.0 MVKTDDHQAPDNNNNNNNMIKSTTKKKSSSMMVKKFKGVRMRSWGSWVSEIRAPNQKTRIWLGSYSTPEAAARAYDAALLCLKGSSAAAPTLNFPTSSYA HYHTYTSAAPVAAPMSPKSIQRIAAAAAANAPTTDIIHQQPPQPQPSLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAAADVRRLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G21910	AP2_ERF	DREB26	dehydration response element-b...		Lus10003740 [exp]	0	1
AT3G54690		SETH3	Sugar isomerase (SIS) family p...		Lus10003549 [exp]	1.7	0.8575
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10034098 [exp]	2.0	0.8290
AT2G19590		ATACO1, ACO1	ACC oxidase 1 (.1)		Lus10032682 [exp]	4.2	0.8329
AT1G21910	AP2_ERF	DREB26	dehydration response element-b...		Lus10028032 [exp]	7.1	0.7648
AT5G51480		SKS2	SKU5 similar 2 (.1)		Lus10027207 [exp]	7.3	0.8012
AT2G19590		ATACO1, ACO1	ACC oxidase 1 (.1)		Lus10008564 [exp]	10.9	0.8361
AT3G54690		SETH3	Sugar isomerase (SIS) family p...		Lus10033902 [exp]	12.0	0.7821
AT5G44730			Haloacid dehalogenase-like hyd...		Lus10001353 [exp]	17.2	0.7917
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10029580 [exp]	17.9	0.7399
AT4G12610		RAP74, ATRAP74	transcription activators;DNA b...		Lus10017289 [exp]	27.7	0.7139

Compare expression of checked genes

Lus10003740 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.