Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25060 44 / 5e-06 AtENODL14 early nodulin-like protein 14 (.1) AT1G45063 44 / 9e-06 copper ion binding;electron carriers (.1.2) AT4G27520 43 / 1e-05 AtENODL2 early nodulin-like protein 2 (.1) AT2G32300 42 / 2e-05 UCC1 uclacyanin 1 (.1) AT4G28365 41 / 5e-05 AtENODL3 early nodulin-like protein 3 (.1) AT3G53330 41 / 5e-05 plastocyanin-like domain-containing protein (.1) AT4G30590 40 / 7e-05 AtENODL12 early nodulin-like protein 12 (.1) AT2G26720 40 / 9e-05 Cupredoxin superfamily protein (.1) AT3G20570 40 / 0.0002 AtENODL9 early nodulin-like protein 9 (.1) AT3G27200 39 / 0.0002 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010484 [exp] 163 / 3e-52 AT2G32300 87 / 6e-21 uclacyanin 1 (.1) Lus10019955 [exp] 50 / 2e-08 AT4G30590 120 / 1e-34 early nodulin-like protein 12 (.1) Lus10009196 [exp] 43 / 2e-05 AT5G53870 154 / 3e-44 early nodulin-like protein 1 (.1) Lus10009617 [exp] 41 / 4e-05 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1) Lus10027143 [exp] 39 / 0.0003 AT2G32300 137 / 9e-40 uclacyanin 1 (.1) Lus10022350 [exp] 38 / 0.0008 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1) Lus10041570 [exp] 38 / 0.0008 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1) Lus10027043 [exp] 38 / 0.0009 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G009000 [exp] 105 / 1e-29 AT2G32300 77 / 3e-17 uclacyanin 1 (.1) Potri.016G015200 [exp] 94 / 4e-25 AT3G27200 73 / 1e-16 Cupredoxin superfamily protein (.1) Potri.017G011200 [exp] 42 / 2e-05 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1) Potri.003G150300 [exp] 39 / 0.0004 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1) Potri.001G080700 [exp] 38 / 0.0008 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10003799 pacid=23145953 polypeptide=Lus10003799 locus=Lus10003799.g ID=Lus10003799.BGIv1.0 annot-version=v1.0 ATGGATGTCGGGTTCGTCTACTCTGCTGCAGAGGGAGGGGTCTACGAGCTCGGGTCGAAAGAGGAGTACTACACGTGCGATTCGGCCAACCCAATCAAGA TGTACACGGACGGTCTCAACAGCGCCGGAGAAGGAGTTCGCTACTTTGTAAGCAATAACACTTCAAGCTGCAAGGAAGGTCTCAAGTTACATGTTGAGGT TCTGCCTCGAGAGATTTTGAAGGGAAATGACCGAATTGCCACGACGGTTTCCACATCGAGCTCGGACTCTGTTCTTGCTGTTGGGCCGACAGCTCCCTCG GGCGCGGCCCATGTTGGCCGGAGCCTGCTTTTGGGTGCGGTTGGGTTTGTGCTTTGGTTTGTGGGCCTGTGA
AA sequence Show only first row Show all	>Lus10003799 pacid=23145953 polypeptide=Lus10003799 locus=Lus10003799.g ID=Lus10003799.BGIv1.0 annot-version=v1.0 MDVGFVYSAAEGGVYELGSKEEYYTCDSANPIKMYTDGLNSAGEGVRYFVSNNTSSCKEGLKLHVEVLPREILKGNDRIATTVSTSSSDSVLAVGPTAPS GAAHVGRSLLLGAVGFVLWFVGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10003799 [exp]	0	1
AT5G53970		TAT7	tyrosine aminotransferase 7, T...		Lus10033660 [exp]	3.2	0.8288
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10026198 [exp]	6.3	0.8382
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10010880 [exp]	7.1	0.8357
AT3G28030		UVR1, UVH3	UV REPAIR DEFECTIVE 1, ULTRAVI...		Lus10039482 [exp]	10.1	0.7727
AT4G02500		ATXT2, XXT2	XYG XYLOSYLTRANSFERASE 2, ARAB...		Lus10037520 [exp]	13.3	0.8334
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016497 [exp]	15.3	0.8105
AT1G47410			unknown protein		Lus10006481 [exp]	16.2	0.8366
AT4G03965			RING/U-box superfamily protein...		Lus10029993 [exp]	16.9	0.8169
AT3G58840		PMD1	peroxisomal and mitochondrial ...		Lus10007347 [exp]	17.0	0.8195
					Lus10011339 [exp]	18.5	0.8286

Compare expression of checked genes

Lus10003799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.