Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12010 65 / 2e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G36150 62 / 1e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G45230 60 / 9e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G51570 58 / 5e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G45250 57 / 1e-09 RPS4 RESISTANT TO P. SYRINGAE 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT2G17060 57 / 1e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G46260 56 / 4e-09 disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G44870 54 / 9e-09 TTR1, LAZ5 tolerance to Tobacco ringspot virus 1, LAZARUS 5, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G36930 54 / 1e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G17880 52 / 5e-08 CSA1 constitutive shade-avoidance1, disease resistance protein (TIR-NBS-LRR class) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009107 [exp] 143 / 9e-40 AT4G12010 347 / 4e-101 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10005813 [exp] 114 / 1e-29 AT3G44480 297 / 2e-84 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10006789 [exp] 113 / 3e-29 AT4G12010 325 / 7e-96 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10006732 [exp] 102 / 3e-25 AT4G11170 322 / 8e-97 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10019654 [exp] 100 / 1e-24 AT4G12010 376 / 2e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10018021 [exp] 90 / 5e-21 AT4G12010 434 / 5e-131 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10008221 [exp] 89 / 1e-20 AT4G12010 400 / 8e-120 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10023051 [exp] 86 / 1e-19 AT4G12010 415 / 2e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10008222 [exp] 84 / 6e-19 AT4G12010 327 / 4e-96 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G070700 [exp] 78 / 6e-17 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069500 [exp] 78 / 6e-17 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.T002200 [exp] 71 / 2e-14 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G068300 [exp] 68 / 1e-13 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G019710 [exp] 67 / 3e-13 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 66 / 9e-13 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G014200 [exp] 66 / 1e-12 AT5G36930 673 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G068200 [exp] 66 / 1e-12 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G010800 [exp] 65 / 2e-12 AT5G17680 592 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.011G009400 [exp] 65 / 2e-12 AT5G36930 504 / 4e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00931 [flax] [poplar] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Lus10004074 pacid=23156738 polypeptide=Lus10004074 locus=Lus10004074.g ID=Lus10004074.BGIv1.0 annot-version=v1.0 ATGGATGAGTCACGTCGGGTTGTATCGTATTGCAAGAGAAACCCTTTAGCCTTGAAGGTTCTAGGAGGTGTATTGTTTGGTAAGGACAAAGAGTATTGGG GGAGTTTCATTTTCGGATTGGCAAATATGTCAAAGCCGGAAATTCATTATGTTCTTAGTACAAGCTACTATGCATTGAAAGGCGAAGAGCGAAGAGTATT TATGGATGTTGCTTGTTTCATCCGCGGAACTTCCAAAACTAAGCTGTTGAAATCAGCAGCATCGTGGTTGCTACTTTCTCGAGTCATGCCATTCGGATCT GCGTTGGTGGTGTCACCTCGTCTGGTTATGTTTTTTCTGTGGTTTGGCAAGAAGGTATTAGGTGAAACCCAGAAAGGAACTGAAGACGAAGAAGAAGAAG AACAAGTAATTGGAGTGCCTTGGTATGTAAACTATGCTGGGCATACTGTTTCGTTCCACATTTGTCTATCAAAAGGAGAAGAAGATGTCGAGAAAGTAAA GAAGATGGAGGTCAAAAGGCTTGGCGTCTCGCTAGTCTACTGA
AA sequence Show only first row Show all	>Lus10004074 pacid=23156738 polypeptide=Lus10004074 locus=Lus10004074.g ID=Lus10004074.BGIv1.0 annot-version=v1.0 MDESRRVVSYCKRNPLALKVLGGVLFGKDKEYWGSFIFGLANMSKPEIHYVLSTSYYALKGEERRVFMDVACFIRGTSKTKLLKSAASWLLLSRVMPFGS ALVVSPRLVMFFLWFGKKVLGETQKGTEDEEEEEQVIGVPWYVNYAGHTVSFHICLSKGEEDVEKVKKMEVKRLGVSLVY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36150			Disease resistance protein (TI...		Lus10004074 [exp]	0	1
AT1G19090		CRK1, RKF2	CYSTEINE-RICH RLK \(RECEPTOR-L...		Lus10033389 [exp]	10.8	0.6099
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10028514 [exp]	11.7	0.7462
					Lus10007128 [exp]	23.8	0.6972
AT2G19860		ATHXK2	ARABIDOPSIS THALIANA HEXOKINAS...		Lus10034980 [exp]	24.1	0.7008
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10028513 [exp]	25.0	0.6856
					Lus10021618 [exp]	26.7	0.6977
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10039721 [exp]	41.7	0.6457
AT2G02850		ARPN	plantacyanin (.1)		Lus10018938 [exp]	43.6	0.6569
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10042477 [exp]	44.3	0.5990
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10015190 [exp]	46.8	0.6578

Compare expression of checked genes

Lus10004074 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.