Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27950 76 / 7e-17 AP2_ERF CRF4 cytokinin response factor 4 (.1) AT4G23750 66 / 4e-13 AP2_ERF TMO3, CRF2 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) AT2G46310 60 / 5e-11 AP2_ERF CRF5 cytokinin response factor 5 (.1) AT4G11140 59 / 7e-11 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT3G61630 53 / 1e-08 AP2_ERF CRF6 cytokinin response factor 6 (.1) AT5G53290 50 / 2e-07 AP2_ERF CRF3 cytokinin response factor 3 (.1) AT1G12890 47 / 8e-07 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G28160 47 / 1e-06 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G13910 47 / 1e-06 AP2_ERF LEAFY PETIOLE (LEP) LEAFY PETIOLE, Integrase-type DNA-binding superfamily protein (.1) AT1G15360 47 / 1e-06 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003037 [exp] 93 / 9e-24 AT2G46310 122 / 8e-34 cytokinin response factor 5 (.1) Lus10018756 [exp] 92 / 6e-22 AT1G64280 506 / 2e-170 SALICYLIC ACID INSENSITIVE 1, NON-INDUCIBLE IMMUNITY 1, ARABIDOPSIS NONEXPRESSER OF PR GENES 1, regulatory protein (NPR1) (.1) Lus10027573 [exp] 74 / 1e-15 AT4G27950 209 / 1e-64 cytokinin response factor 4 (.1) Lus10039324 [exp] 67 / 2e-13 AT4G27950 210 / 8e-65 cytokinin response factor 4 (.1) Lus10017550 [exp] 66 / 4e-13 AT4G23750 172 / 2e-51 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Lus10010129 [exp] 64 / 1e-12 AT4G27950 49 / 8e-07 cytokinin response factor 4 (.1) Lus10033938 [exp] 61 / 4e-11 AT4G23750 201 / 6e-62 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Lus10032353 [exp] 61 / 4e-11 AT4G23750 207 / 2e-64 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Lus10033664 [exp] 54 / 2e-09 AT3G15210 119 / 2e-33 RELATED TO AP2 5, ethylene responsive element binding factor 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G094500 [exp] 96 / 5e-24 AT2G46310 163 / 3e-48 cytokinin response factor 5 (.1) Potri.002G167400 [exp] 94 / 2e-23 AT4G27950 162 / 3e-47 cytokinin response factor 4 (.1) Potri.015G023200 [exp] 69 / 4e-14 AT4G27950 211 / 9e-66 cytokinin response factor 4 (.1) Potri.001G094800 [exp] 67 / 1e-13 AT4G23750 177 / 2e-52 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2) Potri.003G136300 [exp] 62 / 1e-11 AT4G11140 160 / 1e-46 cytokinin response factor 1 (.1) Potri.012G032900 [exp] 61 / 2e-11 AT4G27950 214 / 6e-67 cytokinin response factor 4 (.1) Potri.019G131300 [exp] 58 / 2e-10 AT4G27950 139 / 2e-38 cytokinin response factor 4 (.1) Potri.013G158500 [exp] 56 / 1e-09 AT4G27950 124 / 1e-32 cytokinin response factor 4 (.1) Potri.005G219600 [exp] 50 / 4e-08 AT1G50640 85 / 2e-20 ethylene responsive element binding factor 3 (.1) Potri.007G090600 [exp] 49 / 4e-07 AT1G78080 205 / 4e-63 wound induced dedifferentiation 1, related to AP2 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10005149 pacid=23141931 polypeptide=Lus10005149 locus=Lus10005149.g ID=Lus10005149.BGIv1.0 annot-version=v1.0 ATGAGCCGTCTTCCGGCGGCGGACGGGTATTTCAGGGAGCACCGAACGGTCACCCGAAAGGTCCTCGGGGGAGACGAGTTCAACTACATGACCAAAATAG TGCGCGTCTCTGTAACTGACGGTGATGCGACGGACTCTTCCGGCGAGGAGAGCGACGGCGGAAGGCGAGAGACGGTGAGGAAGTACATTCACGAGATCCG TTTGCTAGACCGTTCTGCAGAGCAAGGGACGAAAATGAAGAGGAATTCGAAAAATCAGAAGAGTACTCCTCCTTCCGCCGTGGGTCAGAAATATAGAGGC GTACGCCGGCGGCCGTGGGGGAGGTGGGTGGCGGAGATCAGAAATCCGGTAGAACACCGGAGGTCCTGGCTGGGGGGGTTCGACACGGCGGAGGAAGCCG CGGTGGTGTACGATGAGGCCCCCGCCGGCGGCGATGGAGCAATCCGCGGCGGAGACGGCAGAGGCGTACTTCAAGGAAAATGTGGAGTCATTTCGGGTGG AGGAAGTTGTTGA
AA sequence Show only first row Show all	>Lus10005149 pacid=23141931 polypeptide=Lus10005149 locus=Lus10005149.g ID=Lus10005149.BGIv1.0 annot-version=v1.0 MSRLPAADGYFREHRTVTRKVLGGDEFNYMTKIVRVSVTDGDATDSSGEESDGGRRETVRKYIHEIRLLDRSAEQGTKMKRNSKNQKSTPPSAVGQKYRG VRRRPWGRWVAEIRNPVEHRRSWLGGFDTAEEAAVVYDEAPAGGDGAIRGGDGRGVLQGKCGVISGGGSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Lus10005149 [exp]	0	1
					Lus10041686 [exp]	10.4	0.9021
AT5G57950			26S proteasome regulatory subu...		Lus10036267 [exp]	15.2	0.8236
AT2G43040		NPG1	no pollen germination 1, tetra...		Lus10020725 [exp]	17.5	0.8840
AT2G17030			F-box family protein with a do...		Lus10021517 [exp]	21.4	0.8239
AT2G33420			Protein of unknown function (D...		Lus10011785 [exp]	22.5	0.8824
AT2G30970		ASP1	aspartate aminotransferase 1 (...		Lus10020720 [exp]	23.0	0.8853
AT5G14060		CARAB-AK-LYS	Aspartate kinase family protei...		Lus10012568 [exp]	31.8	0.8795
AT5G60700			glycosyltransferase family pro...		Lus10037396 [exp]	35.5	0.8794
AT1G28510			Optic atrophy 3 protein (OPA3)...		Lus10005273 [exp]	37.8	0.8546
AT4G17550		AtG3Pp4	glycerol-3-phosphate permease ...		Lus10004358 [exp]	38.8	0.8414

Compare expression of checked genes

Lus10005149 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.