Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13420 89 / 3e-20 HAK5, ATHAK5 high affinity K+ transporter 5, ARABIDOPSIS THALIANA HIGH AFFINITY K+ TRANSPORTER 5, high affinity K+ transporter 5 (.1) AT1G60160 87 / 2e-19 Potassium transporter family protein (.1) AT1G31120 81 / 2e-17 KUP10 K+ uptake permease 10, K+ uptake permease 10 (.1) AT2G35060 78 / 1e-16 KUP11 K+ uptake permease 11, K+ uptake permease 11 (.1), K+ uptake permease 11 (.2) AT4G19960 73 / 6e-15 KT9, HAK9, ATKUP9 K+ uptake permease 9, K+ uptake permease 9 (.1), K+ uptake permease 9 (.2) AT5G09400 73 / 8e-15 KUP7 K+ uptake permease 7, K+ uptake permease 7 (.1) AT4G33530 70 / 6e-14 KUP5 K+ uptake permease 5, K+ uptake permease 5 (.1) AT1G70300 68 / 4e-13 KUP6 K+ uptake permease 6, K+ uptake permease 6 (.1) AT5G14880 67 / 9e-13 Potassium transporter family protein (.1) AT2G30070 64 / 1e-11 ATKUP1, ATKT1P, ATKT1 POTASSIUM UPTAKE TRANSPORTER 1, potassium transporter 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013304 [exp] 236 / 8e-73 AT4G13420 950 / 0.0 high affinity K+ transporter 5, ARABIDOPSIS THALIANA HIGH AFFINITY K+ TRANSPORTER 5, high affinity K+ transporter 5 (.1) Lus10012992 [exp] 101 / 1e-24 AT1G70300 1188 / 0.0 K+ uptake permease 6, K+ uptake permease 6 (.1) Lus10036160 [exp] 96 / 8e-23 AT5G09400 1204 / 0.0 K+ uptake permease 7, K+ uptake permease 7 (.1) Lus10003402 [exp] 96 / 8e-23 AT5G09400 1296 / 0.0 K+ uptake permease 7, K+ uptake permease 7 (.1) Lus10030857 [exp] 95 / 2e-22 AT1G70300 1249 / 0.0 K+ uptake permease 6, K+ uptake permease 6 (.1) Lus10030539 [exp] 87 / 2e-19 AT2G40540 1245 / 0.0 potassium transporter 2 (.1.2) Lus10025493 [exp] 84 / 2e-18 AT4G13420 826 / 0.0 high affinity K+ transporter 5, ARABIDOPSIS THALIANA HIGH AFFINITY K+ TRANSPORTER 5, high affinity K+ transporter 5 (.1) Lus10027004 [exp] 84 / 2e-18 AT4G13420 828 / 0.0 high affinity K+ transporter 5, ARABIDOPSIS THALIANA HIGH AFFINITY K+ TRANSPORTER 5, high affinity K+ transporter 5 (.1) Lus10012888 [exp] 80 / 3e-17 AT5G14880 566 / 0.0 Potassium transporter family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G069650 [exp] 183 / 2e-53 AT4G13420 951 / 0.0 high affinity K+ transporter 5, ARABIDOPSIS THALIANA HIGH AFFINITY K+ TRANSPORTER 5, high affinity K+ transporter 5 (.1) Potri.001G045200 [exp] 172 / 1e-49 AT4G13420 978 / 0.0 high affinity K+ transporter 5, ARABIDOPSIS THALIANA HIGH AFFINITY K+ TRANSPORTER 5, high affinity K+ transporter 5 (.1) Potri.001G069799 [exp] 114 / 5e-29 AT4G13420 845 / 0.0 high affinity K+ transporter 5, ARABIDOPSIS THALIANA HIGH AFFINITY K+ TRANSPORTER 5, high affinity K+ transporter 5 (.1) Potri.014G132500 [exp] 94 / 3e-22 AT4G13420 852 / 0.0 high affinity K+ transporter 5, ARABIDOPSIS THALIANA HIGH AFFINITY K+ TRANSPORTER 5, high affinity K+ transporter 5 (.1) Potri.010G094400 [exp] 93 / 8e-22 AT1G60160 1209 / 0.0 Potassium transporter family protein (.1) Potri.003G109800 [exp] 87 / 1e-19 AT2G35060 985 / 0.0 K+ uptake permease 11, K+ uptake permease 11 (.1), K+ uptake permease 11 (.2) Potri.001G123700 [exp] 80 / 4e-17 AT2G35060 1047 / 0.0 K+ uptake permease 11, K+ uptake permease 11 (.1), K+ uptake permease 11 (.2) Potri.003G109700 [exp] 79 / 5e-17 AT2G35060 1155 / 0.0 K+ uptake permease 11, K+ uptake permease 11 (.1), K+ uptake permease 11 (.2) Potri.001G123800 [exp] 79 / 6e-17 AT2G35060 1149 / 0.0 K+ uptake permease 11, K+ uptake permease 11 (.1), K+ uptake permease 11 (.2) Potri.014G144900 [exp] 74 / 3e-15 AT3G02050 1175 / 0.0 K+ uptake transporter 3, ARABIDOPSIS THALIANA POTASSIUM TRANSPORTER 4, K+ uptake transporter 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0062 [flax] [poplar] APC PF02705 [flax] [poplar] K_trans K+ potassium transporter
Representative CDS sequence Show only first row Show all	>Lus10005195 pacid=23145819 polypeptide=Lus10005195 locus=Lus10005195.g ID=Lus10005195.BGIv1.0 annot-version=v1.0 ATGGCTTTCCTTTACTCGGAGCTCGTTCAAGGGATTCCTCCTATCTTCCCTCACTTTGTGGCTAATGTGCCCTCGGTTCATTCCGTGTTGGTGTTTGTTT CGTTGAAGAATCTTCCCATCAGTAAGGTTCTGCCTGAAGAGAGATATGGATACAAAGACGCAATCGAGGAGCCCCACGTATTCGAGCGCCCGTTGGTCGA AAATCTGAAAGAATTCATCCGTCACGAGCACTTCCAACTCCTACGACCGCCACCATTAATTCCGACAACACCACCGAGGAGGCGGCACCATTGCCGAATG GTGGCAGCAGTCGACACGTGTAACAGCGACAACAGCAGCAATAACGGAAACATTGATACGGTCGCTAATGGCATTGGCATTAGCAACCGTGCTAGTAGTG TTAACAAGTCCTCAAATGGGAACAAGGTGGCGGTTGTGGGTCCGGCGGAGGAAGAGATGCAGTTCGTGCAGAAGGCAATGGAGAAAGGAGTTGCGTACCT CCTTGGAGAGGCGGAGATTGTGGCCGAACCGAAGTCGTCGATGCTGAAGAAGATGGTGGTTAATTATGGCTACAGTTTGTTGAGGAAGAATTTCAGGGGA GTGAGAAGGGTTTGGCTGTCCCGCGTAATAGGCTTCTCCGAGTTGGTATGA
AA sequence Show only first row Show all	>Lus10005195 pacid=23145819 polypeptide=Lus10005195 locus=Lus10005195.g ID=Lus10005195.BGIv1.0 annot-version=v1.0 MAFLYSELVQGIPPIFPHFVANVPSVHSVLVFVSLKNLPISKVLPEERYGYKDAIEEPHVFERPLVENLKEFIRHEHFQLLRPPPLIPTTPPRRRHHCRM VAAVDTCNSDNSSNNGNIDTVANGIGISNRASSVNKSSNGNKVAVVGPAEEEMQFVQKAMEKGVAYLLGEAEIVAEPKSSMLKKMVVNYGYSLLRKNFRG VRRVWLSRVIGFSELV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005195 [exp]	0	1

Compare expression of checked genes

Lus10005195 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.