Lus10005229 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27035 110 / 4e-31 AtENODL20 early nodulin-like protein 20 (.1)
AT5G15350 104 / 1e-28 AtENODL17 early nodulin-like protein 17 (.1)
AT4G12880 97 / 3e-26 AtENODL19 early nodulin-like protein 19 (.1.2)
AT3G01070 79 / 7e-19 AtENODL16 early nodulin-like protein 16 (.1)
AT3G27200 69 / 5e-15 Cupredoxin superfamily protein (.1)
AT3G17675 67 / 8e-15 Cupredoxin superfamily protein (.1)
AT5G26330 67 / 3e-14 Cupredoxin superfamily protein (.1)
AT2G32300 67 / 7e-14 UCC1 uclacyanin 1 (.1)
AT2G31050 64 / 4e-13 Cupredoxin superfamily protein (.1)
AT2G26720 62 / 2e-12 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026749 122 / 1e-35 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1)
Lus10025536 108 / 3e-30 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1)
Lus10026064 91 / 2e-23 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1)
Lus10030690 91 / 4e-23 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1)
Lus10005231 91 / 5e-23 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1)
Lus10014356 89 / 1e-22 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1)
Lus10025535 92 / 4e-22 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1)
Lus10012085 68 / 2e-14 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10041570 66 / 8e-14 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G088500 156 / 4e-49 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1)
Potri.001G219800 125 / 1e-36 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1)
Potri.001G219900 122 / 5e-36 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1)
Potri.017G088600 106 / 2e-29 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1)
Potri.003G183300 100 / 1e-26 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.001G043600 96 / 3e-25 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Potri.004G121100 95 / 5e-25 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1)
Potri.008G151000 69 / 7e-15 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.013G030450 67 / 2e-14 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030000 67 / 2e-14 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10005229 pacid=23155688 polypeptide=Lus10005229 locus=Lus10005229.g ID=Lus10005229.BGIv1.0 annot-version=v1.0
ATGGCGGGGACACTGATCATGATGATGATGATGATGATAATGTTGGTGTTGGGAGGCAGTGAGGCCTCACGTCACAAAGTTGGAAGCAAAAATGGATGGA
TCCCTAATTTCAACTACACTCCCTGGTCTTCCCACCAACGTTTCTTCGTCGGCGATTGGCTCTTGTTTGTGTTCGACAAGCGCTATTACAACGTGCTGGA
GGTGAACGTGACGAGCTACGACGTATGCGAGGAACGAGGCTTCATCAACAACGTGACACGTGGAGGGAGAGATGTGGTGGAGCTGACGGAAGCAAGGCCT
TACTATTTCCTCAGCGGCGGTGGATACTGTTGGGGCGGAATGAAAGTTGAAGTCAACGTCACCGCCCAACCAGCTCCGGCTCCGGCTCCGAGTTCCGATC
TACACTCTAATAATGCTCCGGACACTCTAATAATCCCCCGCCCGCCACACCGTTTAATGATCATCGTCATGGCTGTGTTCTTTACCTGA
AA sequence
>Lus10005229 pacid=23155688 polypeptide=Lus10005229 locus=Lus10005229.g ID=Lus10005229.BGIv1.0 annot-version=v1.0
MAGTLIMMMMMMIMLVLGGSEASRHKVGSKNGWIPNFNYTPWSSHQRFFVGDWLLFVFDKRYYNVLEVNVTSYDVCEERGFINNVTRGGRDVVELTEARP
YYFLSGGGYCWGGMKVEVNVTAQPAPAPAPSSDLHSNNAPDTLIIPRPPHRLMIIVMAVFFT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27035 AtENODL20 early nodulin-like protein 20 ... Lus10005229 0 1
AT3G52490 Double Clp-N motif-containing ... Lus10016966 1.7 0.9405
AT1G47890 AtRLP7 receptor like protein 7 (.1) Lus10014905 2.4 0.9308
AT2G23950 Leucine-rich repeat protein ki... Lus10019963 2.6 0.9137
AT5G56270 WRKY ATWRKY2, WRKY2,... ARABIDOPSIS THALIANA WRKY DNA-... Lus10019898 2.8 0.9335
AT5G62890 Xanthine/uracil permease famil... Lus10029191 4.0 0.9306
AT3G52490 Double Clp-N motif-containing ... Lus10021291 5.0 0.9193
AT5G39420 CDC2CAT CDC2C (.1) Lus10005228 6.9 0.9178
AT1G46264 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcr... Lus10001133 7.3 0.8996
AT1G60060 Serine/threonine-protein kinas... Lus10029179 8.1 0.8932
AT5G22350 ELM1 ELONGATED MITOCHONDRIA 1, Prot... Lus10021334 8.8 0.8404

Lus10005229 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.