Lus10005231 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15350 184 / 1e-59 AtENODL17 early nodulin-like protein 17 (.1)
AT3G01070 129 / 3e-38 AtENODL16 early nodulin-like protein 16 (.1)
AT4G12880 124 / 2e-36 AtENODL19 early nodulin-like protein 19 (.1.2)
AT2G27035 90 / 1e-22 AtENODL20 early nodulin-like protein 20 (.1)
AT5G26330 62 / 4e-12 Cupredoxin superfamily protein (.1)
AT3G20570 62 / 5e-12 AtENODL9 early nodulin-like protein 9 (.1)
AT2G25060 62 / 6e-12 AtENODL14 early nodulin-like protein 14 (.1)
AT5G53870 61 / 3e-11 AtENODL1 early nodulin-like protein 1 (.1)
AT2G23990 61 / 3e-11 AtENODL11 early nodulin-like protein 11 (.1.2)
AT2G31050 58 / 1e-10 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030690 363 / 4e-130 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1)
Lus10026064 98 / 1e-25 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1)
Lus10026749 94 / 4e-24 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1)
Lus10014356 89 / 2e-22 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1)
Lus10005229 89 / 2e-22 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1)
Lus10025535 86 / 1e-19 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1)
Lus10012085 66 / 2e-13 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10007026 64 / 5e-13 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10043063 64 / 2e-12 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G088600 227 / 2e-76 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1)
Potri.004G121100 198 / 4e-65 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1)
Potri.001G043600 107 / 1e-29 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Potri.003G183300 107 / 3e-29 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.017G088500 100 / 2e-26 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1)
Potri.001G219900 90 / 9e-23 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1)
Potri.001G219800 88 / 1e-21 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1)
Potri.003G047300 72 / 1e-15 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.002G052500 65 / 2e-13 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.013G030450 63 / 2e-12 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10005231 pacid=23155682 polypeptide=Lus10005231 locus=Lus10005231.g ID=Lus10005231.BGIv1.0 annot-version=v1.0
ATGGAGCAGAAGCTTAGCTTGTTCAACTCGCCTCTGCTGATTGCAGCGGCGGTGGTTGTGCTCTGCGCTGCCATGGCACCGGAAGTCACTGCCAAGAGAT
ACACAGTCGGATCCAACATGGGTTGGACTACTAATGTCAATTACTCCATTTGGGCTCAGGATTTGCACTTCTACAATGACGACTGGCTCTGCATATTTGC
CTTGGAGATGTCTGACATTGGGAAGCTTGCAGTTTTCGTGTACGACAGGAACCAGATGAACGTGCTGGAGGTGAACAAGACCGACTACGAGAGTTGCAAC
GCCGACCACCCGCTCCACAACTGGACCACCGGTGCAGGAAGGGACGTGGTTCCCCTCAACGTGACTCGCCACTACTACTTCATCAGCGGTAAAGGGTTCT
GTTACGGAGGCATGAAGTTGGCTCTCCGCGTCGAGAAACACCCTCCTCCGCCAACCGCTTCACCCGTCAAGAGCGATGCTTCTCCCATCAGCATTCTCGG
CCTTGGGAGCTGCGGCCGATACGTGCTGCCTGCAGTTTTCGCCATCGGAGCGTTGTGGGATGGATTCGTTCACCTCTGGTAG
AA sequence
>Lus10005231 pacid=23155682 polypeptide=Lus10005231 locus=Lus10005231.g ID=Lus10005231.BGIv1.0 annot-version=v1.0
MEQKLSLFNSPLLIAAAVVVLCAAMAPEVTAKRYTVGSNMGWTTNVNYSIWAQDLHFYNDDWLCIFALEMSDIGKLAVFVYDRNQMNVLEVNKTDYESCN
ADHPLHNWTTGAGRDVVPLNVTRHYYFISGKGFCYGGMKLALRVEKHPPPPTASPVKSDASPISILGLGSCGRYVLPAVFAIGALWDGFVHLW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Lus10005231 0 1
AT4G37450 ATAGP18, AGP18 arabinogalactan protein 18 (.... Lus10011520 2.4 0.8526
AT4G08685 SAH7 Pollen Ole e 1 allergen and ex... Lus10042201 2.8 0.8722
AT2G01818 PLATZ transcription factor fam... Lus10013242 8.2 0.7043
AT5G15650 REVERSIBLYGLYCO... reversibly glycosylated polype... Lus10017868 12.0 0.7773
AT1G27970 NTF2B nuclear transport factor 2B (.... Lus10037033 12.8 0.8113
AT5G40150 Peroxidase superfamily protein... Lus10032170 14.3 0.7814
AT5G25830 GATA GATA12 GATA transcription factor 12 (... Lus10002036 16.6 0.7867
AT1G50010 TUA2 tubulin alpha-2 chain (.1) Lus10035422 18.3 0.8036
AT2G40300 ATFER4 ferritin 4 (.1) Lus10017433 21.4 0.7166
AT3G60910 S-adenosyl-L-methionine-depend... Lus10016376 22.9 0.6733

Lus10005231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.