Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G28910 147 / 7e-45 MYB AtMYB30, MYB30 myb domain protein 30 (.1) AT3G47600 146 / 1e-44 MYB ATMYB94, AtMYBCP70 myb domain protein 94 (.1) AT1G08810 144 / 3e-44 MYB ATMYB60 myb domain protein 60 (.1.2) AT1G74650 143 / 1e-43 MYB ATMYB31 AtY13 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 31, myb domain protein 31 (.1) AT5G62470 144 / 2e-43 MYB ATMYB96, mybcov1 myb domain protein 96 (.1.2) AT2G31180 122 / 4e-36 MYB ATMYB14, Myb14at ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 14, myb domain protein 14 (.1) AT3G23250 120 / 6e-35 MYB ATMYB15, ATY19 myb domain protein 15 (.1.2) AT5G15310 120 / 7e-35 MYB ATMYB16, ATMIXTA myb domain protein 16 (.1.2) AT4G28110 119 / 9e-35 MYB ATMYB41 myb domain protein 41 (.1) AT3G02940 120 / 1e-34 MYB ATMYB107 myb domain protein 107 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005245 [exp] 168 / 2e-53 AT3G47600 289 / 6e-97 myb domain protein 94 (.1) Lus10030677 [exp] 167 / 5e-53 AT3G47600 293 / 1e-98 myb domain protein 94 (.1) Lus10002056 [exp] 150 / 2e-46 AT5G62470 320 / 6e-109 myb domain protein 96 (.1.2) Lus10024218 [exp] 147 / 2e-45 AT3G47600 305 / 2e-103 myb domain protein 94 (.1) Lus10015369 [exp] 147 / 7e-45 AT3G28910 293 / 2e-98 myb domain protein 30 (.1) Lus10009522 [exp] 145 / 1e-44 AT1G08810 284 / 9e-96 myb domain protein 60 (.1.2) Lus10042200 [exp] 147 / 2e-44 AT5G62470 330 / 2e-111 myb domain protein 96 (.1.2) Lus10020343 [exp] 145 / 3e-44 AT1G08810 286 / 1e-96 myb domain protein 60 (.1.2) Lus10008616 [exp] 145 / 2e-43 AT3G47600 322 / 2e-108 myb domain protein 94 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G126700 [exp] 149 / 1e-45 AT3G28910 310 / 2e-104 myb domain protein 30 (.1) Potri.017G082500 [exp] 147 / 4e-45 AT3G47600 319 / 2e-108 myb domain protein 94 (.1) Potri.013G067500 [exp] 146 / 1e-44 AT1G08810 293 / 8e-99 myb domain protein 60 (.1.2) Potri.019G045900 [exp] 145 / 2e-44 AT1G08810 298 / 5e-101 myb domain protein 60 (.1.2) Potri.019G118200 [exp] 122 / 3e-35 AT4G05100 278 / 7e-92 myb domain protein 74 (.1) Potri.019G018200 [exp] 119 / 4e-35 AT2G31180 223 / 1e-73 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 14, myb domain protein 14 (.1) Potri.013G148600 [exp] 122 / 5e-35 AT4G21440 269 / 4e-88 A. THALIANA MYB 4, MYB-like 102 (.1) Potri.017G086300 [exp] 121 / 2e-34 AT5G15310 343 / 6e-117 myb domain protein 16 (.1.2) Potri.004G033100 [exp] 120 / 2e-34 AT4G21440 293 / 4e-97 A. THALIANA MYB 4, MYB-like 102 (.1) Potri.005G074500 [exp] 118 / 1e-33 AT1G34670 290 / 1e-96 myb domain protein 93 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF00249 [flax] [poplar] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Lus10005243 pacid=23155712 polypeptide=Lus10005243 locus=Lus10005243.g ID=Lus10005243.BGIv1.0 annot-version=v1.0 ATGGGAAGAGCACCGTGCTGTGATGCAGGGGGAGTCAAGAAAAGGCCATGGACTCCTGAAGATGACATCCTCCTCGTCTCGTACATTCACCACCATGGCC CTTCTAACTGGAGATCCATCCCCCCCACCACTGGTTCATGCAGCAAAAGCTGCCGGCTGAGATGGACTAATTACCTTCGTCCTGGGATCAAACGTGGCAA TTTCACTCACCAAGAAGACCAAATGATCATCCATCTCCAAGCCCTTCTTGGCAACAGTTCAATTAAATAA
AA sequence Show only first row Show all	>Lus10005243 pacid=23155712 polypeptide=Lus10005243 locus=Lus10005243.g ID=Lus10005243.BGIv1.0 annot-version=v1.0 MGRAPCCDAGGVKKRPWTPEDDILLVSYIHHHGPSNWRSIPPTTGSCSKSCRLRWTNYLRPGIKRGNFTHQEDQMIIHLQALLGNSSIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47600	MYB	ATMYB94, AtMYBC...	myb domain protein 94 (.1)		Lus10005243 [exp]	0	1

Compare expression of checked genes

Lus10005243 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.