Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23240 119 / 2e-34 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT5G47220 108 / 6e-30 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT4G17500 107 / 4e-29 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1) AT2G44840 104 / 2e-28 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT5G51190 98 / 4e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G43410 96 / 4e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G17490 99 / 7e-26 AP2_ERF ERF-6-6, ATERF6 ethylene responsive element binding factor 6 (.1) AT2G31230 98 / 7e-26 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1) AT3G23230 96 / 7e-26 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT5G47230 97 / 5e-25 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013959 [exp] 183 / 1e-60 AT3G23240 124 / 2e-36 ethylene response factor 1 (.1) Lus10025430 [exp] 150 / 3e-47 AT3G23240 132 / 6e-39 ethylene response factor 1 (.1) Lus10006579 [exp] 111 / 6e-31 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1) Lus10004368 [exp] 106 / 2e-28 AT4G17500 268 / 7e-90 ethylene responsive element binding factor 1 (.1) Lus10014655 [exp] 105 / 2e-28 AT3G23240 202 / 3e-65 ethylene response factor 1 (.1) Lus10021193 [exp] 105 / 2e-28 AT3G23240 209 / 2e-68 ethylene response factor 1 (.1) Lus10003562 [exp] 103 / 6e-28 AT3G23240 146 / 1e-43 ethylene response factor 1 (.1) Lus10033885 [exp] 102 / 3e-27 AT3G23240 142 / 7e-42 ethylene response factor 1 (.1) Lus10022936 [exp] 97 / 1e-26 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G051700 [exp] 137 / 9e-42 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) Potri.011G061700 [exp] 125 / 3e-37 AT3G23240 111 / 1e-30 ethylene response factor 1 (.1) Potri.013G045200 [exp] 109 / 2e-30 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1) Potri.003G081200 [exp] 107 / 3e-29 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1) Potri.001G154100 [exp] 107 / 3e-29 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1) Potri.019G014409 [exp] 104 / 1e-28 AT3G23240 161 / 1e-49 ethylene response factor 1 (.1) Potri.004G051800 [exp] 102 / 3e-27 AT4G18450 127 / 7e-35 Integrase-type DNA-binding superfamily protein (.1) Potri.008G166200 [exp] 100 / 8e-27 AT3G23240 202 / 1e-65 ethylene response factor 1 (.1) Potri.003G150800 [exp] 101 / 1e-26 AT5G51190 185 / 7e-58 Integrase-type DNA-binding superfamily protein (.1) Potri.011G061800 [exp] 100 / 2e-26 AT4G18450 134 / 2e-37 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10005285 pacid=23175310 polypeptide=Lus10005285 locus=Lus10005285.g ID=Lus10005285.BGIv1.0 annot-version=v1.0 ATGAGCTCAGCACAGCTGCCTTTCAAAGAGAACGACTCCCAGGATATGGTGATCCTCCACATGATGACCCAACCCACCACCACAGGAGGAGGAAGAGGAA GTAACCCGGAATTCAACCCGATCCAGCACCCGTCCAGCCGGGTCATATGGAAACCACACTACAGAGGCGTCCGTCGCCGGCCGTGGGGTAAATACGCCGC CGAAATCCGTGATTCTTCCCGGCACGGTGTGATGGTCTGGCTCGGAACGTTCGAGACTGCTGAAGATGGCGCGGTCGCTTACAATCGCACTGCCTTCCGG ATGCGGGGATCCATGGCCGTCCTCAACTTCCCGCCGGAGGTGCAGGGGATGGTTGGTGGTGATCAGCCAGGAAGAAAGCCAGCTCGACAGCCGGGGAGTG ATTATATGAGTACTGATCAATCGAATTGTAGCTTCAGATAG
AA sequence Show only first row Show all	>Lus10005285 pacid=23175310 polypeptide=Lus10005285 locus=Lus10005285.g ID=Lus10005285.BGIv1.0 annot-version=v1.0 MSSAQLPFKENDSQDMVILHMMTQPTTTGGGRGSNPEFNPIQHPSSRVIWKPHYRGVRRRPWGKYAAEIRDSSRHGVMVWLGTFETAEDGAVAYNRTAFR MRGSMAVLNFPPEVQGMVGGDQPGRKPARQPGSDYMSTDQSNCSFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Lus10005285 [exp]	0	1
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Lus10037156 [exp]	13.7	0.8754
AT5G18650			CHY-type/CTCHY-type/RING-type ...		Lus10033969 [exp]	14.1	0.8579
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10020070 [exp]	16.0	0.8580
AT2G24100		ASG1	ALTERED SEED GERMINATION 1, un...		Lus10024097 [exp]	17.4	0.8607
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Lus10036773 [exp]	25.5	0.8253
AT4G18750		DOT4	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10033946 [exp]	25.7	0.7685
AT3G07350			Protein of unknown function (D...		Lus10002335 [exp]	30.3	0.8501
AT3G13750		BGAL1	beta-galactosidase 1, beta gal...		Lus10015625 [exp]	33.1	0.8491
AT2G04220			Plant protein of unknown funct...		Lus10039183 [exp]	36.7	0.7716
					Lus10012525 [exp]	46.7	0.8309

Compare expression of checked genes

Lus10005285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.