Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15360 210 / 4e-69 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 188 / 1e-60 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 182 / 3e-58 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT5G25190 97 / 6e-25 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT5G53290 72 / 1e-14 AP2_ERF CRF3 cytokinin response factor 3 (.1) AT2G22200 69 / 8e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G71450 67 / 9e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G22190 68 / 2e-13 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1) AT2G47520 66 / 2e-13 AP2_ERF AtERF71, ERF71, HRE2 HYPOXIA RESPONSIVE ERF \(ETHYLENE RESPONSE FACTOR\) 2, Arabidopsis thaliana ethylene response factor 71, Integrase-type DNA-binding superfamily protein (.1) AT4G27950 68 / 3e-13 AP2_ERF CRF4 cytokinin response factor 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030097 [exp] 347 / 5e-123 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 221 / 4e-73 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 198 / 1e-64 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 168 / 8e-53 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10043271 [exp] 166 / 2e-51 AT1G15360 160 / 2e-49 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002912 [exp] 155 / 8e-48 AT5G25390 187 / 6e-61 shine3, Integrase-type DNA-binding superfamily protein (.1.2) Lus10003506 [exp] 118 / 7e-34 AT1G15360 105 / 3e-29 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10041023 [exp] 99 / 1e-25 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10035859 [exp] 89 / 5e-22 AT5G25190 196 / 9e-65 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G131400 [exp] 254 / 3e-86 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 237 / 9e-80 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 211 / 7e-70 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 198 / 4e-64 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 196 / 5e-64 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 94 / 1e-23 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 94 / 1e-23 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 94 / 1e-23 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.003G054100 [exp] 68 / 4e-14 AT1G71450 144 / 8e-44 Integrase-type DNA-binding superfamily protein (.1) Potri.013G101100 [exp] 68 / 4e-14 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10005716 pacid=23175361 polypeptide=Lus10005716 locus=Lus10005716.g ID=Lus10005716.BGIv1.0 annot-version=v1.0 ATGGTGCAATCAAAGAAGTTCAGAGGCGTCAGACAGCGTCATTGGGGCTCCTGGGTCTCCGAAATTCGACACCCTTTACTGAAACGTAGAATTTGGCTGG GGACATTCGAAACGGCCGAGGAGGCCGCCAGAGCATATGACCAAGCGGCTATTCTTATGAGCGGCAGGAATGCCAAAACTAACTTCCCCATTTCTCAATC ATCAGATGATAATACCAAATTACCCTCCTCCCAATCGTCGGACAATGGGCTGTCGGAGAAACTGCACGCAAAGCTCCGCAAATGCAGCAAGACGCCGTCG CCCTCCATGACCTGCCTTAGGCTTGACACTGAGAATTCTCACATTGGAGTTTGGCAGAAGCGAGCTGGCCAGCGATCCGATTCCAATTGGGTCATGACCG TCCACCTCGGCAATCAATCTTCCACCGACGATAATAGTCCGGAAGTGGCGAAACCAACATCGGCGGGGGGGGGGGGGCAAACCAGACCGGGAGGAATTGA GGAAGAGGAGAGAATTGCGTTGCAGATGATTGAGGAATTGCTCAATCGGAATTGTCCAAGTCCCAGTCGCGGGTTCGGAGCCGACGGGACAACGGCGCCG GCGCCGGCGGAGGAAGAAGTGGAGGAGCTGAATCAGCTTCTGGTTGACGATGACTTTTTCAAATAA
AA sequence Show only first row Show all	>Lus10005716 pacid=23175361 polypeptide=Lus10005716 locus=Lus10005716.g ID=Lus10005716.BGIv1.0 annot-version=v1.0 MVQSKKFRGVRQRHWGSWVSEIRHPLLKRRIWLGTFETAEEAARAYDQAAILMSGRNAKTNFPISQSSDDNTKLPSSQSSDNGLSEKLHAKLRKCSKTPS PSMTCLRLDTENSHIGVWQKRAGQRSDSNWVMTVHLGNQSSTDDNSPEVAKPTSAGGGGQTRPGGIEEEERIALQMIEELLNRNCPSPSRGFGADGTTAP APAEEEVEELNQLLVDDDFFK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10005716 [exp]	0	1
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Lus10007624 [exp]	7.0	0.8258
AT1G69850		NTL1, ATNRT1:2	nitrate transporter 1:2 (.1)		Lus10005417 [exp]	9.9	0.8098
AT4G16730		AtTPS02	terpene synthase 02 (.1)		Lus10018390 [exp]	10.7	0.8160
AT1G12450			SNARE associated Golgi protein...		Lus10008915 [exp]	12.3	0.7455
AT2G20870			cell wall protein precursor, p...		Lus10018569 [exp]	16.1	0.7999
AT3G49190			O-acyltransferase (WSD1-like) ...		Lus10033678 [exp]	16.7	0.7570
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10012552 [exp]	16.9	0.7985
AT3G55150		ATEXO70H1	exocyst subunit exo70 family p...		Lus10023455 [exp]	17.5	0.7843
AT1G04730		CTF18	CHROMOSOME TRANSMISSION FIDELI...		Lus10032615 [exp]	19.7	0.7874
AT1G61390			S-locus lectin protein kinase ...		Lus10031605 [exp]	20.0	0.7434

Compare expression of checked genes

Lus10005716 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.