Lus10006027 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G49630 68 / 9e-15 AAP6 amino acid permease 6 (.1)
AT1G44100 66 / 4e-14 AAP5 amino acid permease 5 (.1)
AT1G58360 66 / 7e-14 NAT2, AAP1 NEUTRAL AMINO ACID TRANSPORTER 2, amino acid permease 1 (.1)
AT1G77380 63 / 6e-13 AAP3, ATAAP3 amino acid permease 3 (.1)
AT1G10010 63 / 7e-13 AAP8, ATAAP8 amino acid permease 8 (.1)
AT5G09220 60 / 8e-12 AAP2 amino acid permease 2 (.1)
AT5G63850 57 / 6e-11 AAP4 amino acid permease 4 (.1)
AT5G23810 52 / 3e-09 AAP7 amino acid permease 7 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029702 64 / 5e-13 AT1G77380 706 / 0.0 amino acid permease 3 (.1)
Lus10042740 63 / 6e-13 AT1G77380 698 / 0.0 amino acid permease 3 (.1)
Lus10029703 63 / 7e-13 AT1G44100 688 / 0.0 amino acid permease 5 (.1)
Lus10007235 62 / 2e-12 AT5G49630 720 / 0.0 amino acid permease 6 (.1)
Lus10028236 61 / 3e-12 AT5G49630 687 / 0.0 amino acid permease 6 (.1)
Lus10036777 59 / 2e-11 AT1G77380 684 / 0.0 amino acid permease 3 (.1)
Lus10037150 59 / 2e-11 AT1G77380 680 / 0.0 amino acid permease 3 (.1)
Lus10028546 57 / 6e-11 AT1G77380 552 / 0.0 amino acid permease 3 (.1)
Lus10018852 57 / 9e-11 AT1G77380 702 / 0.0 amino acid permease 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G236000 71 / 8e-16 AT1G10010 580 / 0.0 amino acid permease 8 (.1)
Potri.006G236100 66 / 1e-14 AT5G49630 107 / 1e-27 amino acid permease 6 (.1)
Potri.002G112100 66 / 9e-14 AT5G49630 691 / 0.0 amino acid permease 6 (.1)
Potri.005G181600 62 / 1e-12 AT1G77380 746 / 0.0 amino acid permease 3 (.1)
Potri.007G100100 62 / 1e-12 AT5G09220 768 / 0.0 amino acid permease 2 (.1)
Potri.005G181500 62 / 2e-12 AT1G77380 728 / 0.0 amino acid permease 3 (.1)
Potri.005G068900 61 / 3e-12 AT5G09220 799 / 0.0 amino acid permease 2 (.1)
Potri.002G079400 61 / 3e-12 AT1G77380 765 / 0.0 amino acid permease 3 (.1)
Potri.002G079500 61 / 4e-12 AT1G77380 766 / 0.0 amino acid permease 3 (.1)
Potri.002G079700 61 / 4e-12 AT1G77380 756 / 0.0 amino acid permease 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0062 APC PF01490 Aa_trans Transmembrane amino acid transporter protein
Representative CDS sequence
>Lus10006027 pacid=23146570 polypeptide=Lus10006027 locus=Lus10006027.g ID=Lus10006027.BGIv1.0 annot-version=v1.0
ATGAGGTTAGTTGGAAGGACGTCGTTAGTATTAGCAGCAACTGTGGTGGCAATGGCTGTACCGTTTTTCAATGACGTCCTGGCACTTCTGGGAGCCATCT
CGTACTGGCCTTTGACCGTGTATTTCCCGGTGGAGATGCACATTGCGCAGAGCAACCTGATTAAGAAGAGCAGTGGCCTTGGCCGCAAAATGGGTAGTAC
TGCAGCTTCTGAATGTGTTGTGCTTAGTGGTGGCTATTGCAGCAGCTTGTGGTGGCATCCATGGTCTCTGTACTTCTCTTATAATGAAGTGTCACAATAA
AA sequence
>Lus10006027 pacid=23146570 polypeptide=Lus10006027 locus=Lus10006027.g ID=Lus10006027.BGIv1.0 annot-version=v1.0
MRLVGRTSLVLAATVVAMAVPFFNDVLALLGAISYWPLTVYFPVEMHIAQSNLIKKSSGLGRKMGSTAASECVVLSGGYCSSLWWHPWSLYFSYNEVSQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G49630 AAP6 amino acid permease 6 (.1) Lus10006027 0 1
Lus10015042 16.7 0.5855
AT1G64760 O-Glycosyl hydrolases family 1... Lus10020526 22.1 0.6344
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10034098 23.0 0.6262
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10030995 48.5 0.5963
AT5G59530 2-oxoglutarate (2OG) and Fe(II... Lus10000610 56.2 0.5248
AT1G63980 D111/G-patch domain-containing... Lus10017524 63.6 0.5789
AT2G13570 CCAAT NF-YB7 "nuclear factor Y, subunit B7"... Lus10020899 81.2 0.5181
AT4G14103 F-box/RNI-like superfamily pro... Lus10020634 102.5 0.5263
AT4G18160 KCO6, ATTPK3, A... Ca2+ activated outward rectify... Lus10004611 109.5 0.5022
AT1G72470 ATEXO70D1 exocyst subunit exo70 family p... Lus10001112 115.9 0.4523

Lus10006027 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.