Lus10006134 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49960 183 / 4e-54 Xanthine/uracil permease family protein (.1)
AT1G60030 164 / 7e-47 ATNAT7 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 7, nucleobase-ascorbate transporter 7 (.1)
AT5G62890 152 / 4e-43 Xanthine/uracil permease family protein (.1.2.3.4)
AT5G49990 152 / 2e-42 Xanthine/uracil permease family protein (.1)
AT2G34190 144 / 2e-39 Xanthine/uracil permease family protein (.1)
AT5G25420 142 / 2e-39 Xanthine/uracil/vitamin C permease (.1)
AT1G10540 142 / 8e-39 ATNAT8 nucleobase-ascorbate transporter 8 (.1)
AT1G65550 142 / 9e-39 Xanthine/uracil permease family protein (.1)
AT2G05760 140 / 2e-38 Xanthine/uracil permease family protein (.1)
AT2G26510 104 / 1e-25 PDE135 pigment defective embryo 135, Xanthine/uracil permease family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033773 280 / 2e-91 AT1G49960 695 / 0.0 Xanthine/uracil permease family protein (.1)
Lus10004228 164 / 4e-47 AT5G62890 972 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4)
Lus10042138 164 / 1e-46 AT5G62890 932 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4)
Lus10034125 160 / 4e-45 AT1G49960 944 / 0.0 Xanthine/uracil permease family protein (.1)
Lus10029191 155 / 9e-44 AT5G62890 914 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4)
Lus10010707 155 / 1e-43 AT5G62890 916 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4)
Lus10007289 146 / 1e-41 AT2G34190 512 / 0.0 Xanthine/uracil permease family protein (.1)
Lus10030014 145 / 5e-40 AT2G05760 927 / 0.0 Xanthine/uracil permease family protein (.1)
Lus10029238 144 / 2e-39 AT2G34190 926 / 0.0 Xanthine/uracil permease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G086800 200 / 9e-61 AT1G49960 727 / 0.0 Xanthine/uracil permease family protein (.1)
Potri.015G072600 160 / 1e-45 AT5G62890 908 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4)
Potri.012G077400 160 / 2e-45 AT5G62890 914 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4)
Potri.010G095500 157 / 3e-44 AT1G60030 869 / 0.0 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 7, nucleobase-ascorbate transporter 7 (.1)
Potri.008G146400 157 / 3e-44 AT1G60030 881 / 0.0 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 7, nucleobase-ascorbate transporter 7 (.1)
Potri.011G068200 153 / 7e-43 AT2G34190 928 / 0.0 Xanthine/uracil permease family protein (.1)
Potri.004G058800 150 / 5e-42 AT2G34190 927 / 0.0 Xanthine/uracil permease family protein (.1)
Potri.014G157800 149 / 1e-41 AT2G05760 930 / 0.0 Xanthine/uracil permease family protein (.1)
Potri.014G015100 128 / 5e-34 AT1G65550 559 / 0.0 Xanthine/uracil permease family protein (.1)
Potri.002G129400 125 / 1e-32 AT2G26510 751 / 0.0 pigment defective embryo 135, Xanthine/uracil permease family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0062 APC PF00860 Xan_ur_permease Permease family
Representative CDS sequence
>Lus10006134 pacid=23176726 polypeptide=Lus10006134 locus=Lus10006134.g ID=Lus10006134.BGIv1.0 annot-version=v1.0
ATGGTAGCAGCAGGCAGTTGCGCAACTTCACATGCTTCCACCAACGACGACGACGACTTCAAGCCTTTCCCGGCGTCGAGTATTGCGTCAACAGCAATCC
TTGCTGGTCTCGTAACTACAGGGAGTCCGTTGTCCTGGTTCTCGTCCGCTTGCTTATTTATTTCTGATTTACCTATCGGCAACCAGAATTTTGATTTGAT
TCGAGACATCTTCGAAGCTGAAGCAATAATTTTAGGCTTTCAGCAGTACCTGGTGATGCTCGGCACTACTGTCACCATCCCAACCATACTTGTTCCTCTG
ATGGGCGGTGGTAATGTGGAGAAGGCTGAGATGATCAATTCATTGCTCTTTGTCTCGGCAATAAGCACTTTGTTACAAACTTGGTTTGGCACTCGGCTTC
CAGTCGTGATGGGAGGATCTTATGCTTTCGTTATCCCTGCAATCTCCATTGCTTTATCGATTAACAGTAGCAAGAGCAGCGCAAATTTGAGTGACCATGT
TCGGTTTAAGAAATCGCTGGCAGCGATACTGGGAGCGATTACCATTGTATCTTTACTTCAAGTGGTGATTGGTTACTTTGGTCTGGCAAGGGTTTGTTCA
AGATTCCTAAGCCCTCTTGCTGCCGCACCTCTTGTGATACTCACTGGTCTTGGCCTCTTTGTACATGGATTTCCGCAGGCGGCCAAATGTGCTGAAGTTG
CACTCCCAGCACTACTTTTTCTCGTTTTCTTGTCTCAAGTGGGGCGGCTGACCATATCTCTTGCAGTACCTTCCTCATATGTTGAACTCAAGAAGAACCA
TATCAGATAG
AA sequence
>Lus10006134 pacid=23176726 polypeptide=Lus10006134 locus=Lus10006134.g ID=Lus10006134.BGIv1.0 annot-version=v1.0
MVAAGSCATSHASTNDDDDFKPFPASSIASTAILAGLVTTGSPLSWFSSACLFISDLPIGNQNFDLIRDIFEAEAIILGFQQYLVMLGTTVTIPTILVPL
MGGGNVEKAEMINSLLFVSAISTLLQTWFGTRLPVVMGGSYAFVIPAISIALSINSSKSSANLSDHVRFKKSLAAILGAITIVSLLQVVIGYFGLARVCS
RFLSPLAAAPLVILTGLGLFVHGFPQAAKCAEVALPALLFLVFLSQVGRLTISLAVPSSYVELKKNHIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G49960 Xanthine/uracil permease famil... Lus10006134 0 1
Lus10013619 2.4 0.8686
AT2G45220 Plant invertase/pectin methyle... Lus10027206 4.2 0.8163
AT3G18400 NAC ANAC058 NAC domain containing protein ... Lus10009029 6.9 0.8612
AT3G26040 HXXXD-type acyl-transferase fa... Lus10021391 8.5 0.8086
AT5G14230 unknown protein Lus10036990 12.7 0.8533
AT5G19410 ABCG23 ATP-binding cassette G23, ABC-... Lus10000737 13.9 0.7982
AT3G01420 PADOX-1, ALPHA-... plant alpha dioxygenase 1, alp... Lus10039436 15.3 0.8114
AT5G58860 CYP86A1 "cytochrome P450, family 86, s... Lus10018217 21.5 0.8201
AT4G15440 CYP74B2, HPL1 hydroperoxide lyase 1 (.1) Lus10030032 23.8 0.7764
AT3G26040 HXXXD-type acyl-transferase fa... Lus10021392 23.9 0.7713

Lus10006134 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.